Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0788 IGR0790 IGR0786 IGR0789 IGR0791 IGR0792 IGR0793 IGR0787 IGR0785 NG0955 NG0959 rph,rnpH, - NG0958 lysC,ak, - NG0956 NG0957 NG0953 hesA, - NG0960 pncB, - NG0962 NG0952 NG0955 NG0959 rph,rnpH, - NG0958 lysC,ak, - NG0956 NG0957 NG0953 hesA, - NG0960 pncB, - NG0962 NG0952 Type: tandem, Name:  - 39 Type: direct, Name:  - 129 NG0955 NG0959 rph,rnpH, - NG0958 lysC,ak, - NG0956 NG0957 NG0953 hesA, - NG0960 pncB, - NG0962 NG0952 NG0961 NG0961
* Calculated from Protein Sequence

Gene ID: NG0956

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lysC  ak  

Definition:
aspartokinase, alpha and beta chains

Gene Start:
931143

Gene Stop:
929929

Gene Length:
1215

Molecular Weight*:
43387

pI*:
5.00

Net Charge*:
-11.37

EC:
2.7.2.4  

Functional Class:
Amino acid biosynthesis; Aspartate family  

Pathway: pathway table
Glycine, serine and threonine metabolism
Lysine biosynthesis

Secondary Evidence:
Cirillo,J.D., Weisbrod,T.R., Pascopella,L., Bloom,B.R. and Jacobs,W.R. Jr.
Isolation and characterization of the aspartokinase and aspartate semialdehyde dehydrogenase operon from mycobacteria.
Mol. Microbiol. 11 (4): 629-639 (1994)
[Medline: 94254720].

Comment:
From GenBANK (gi:1168399): AK catalyzes the reaction: ATP + l-aspartate = ADP + 4-phospho-l-aspartate. AK is subject to feedback inhibition by lysine and threonine. It is involved in the first step in the common biosynthetic pathway leading from Asp to the cell wall precursor meso-diaminopimelate, to Lys, to Met, to Ile and to Thr. This tetramer consisting of two alpha (catalytic) and two beta (function not known) chains has a unique feature: the alpha and beta subunits of aspartokinase are produced by the use of alternative initiation sites.

Oklahoma ID: NGO.956c

Blast Summary:  PSI-Blast Search
NG0956 is orthologous to AE002499, N. meningitidis MC58 aspartokinase, alpha and beta subunits: residues 1-405 have 98% similarity to residues 1-405 in NG0956.

NG0956 also has many very strong hits (P-value < 1e-100) to aspartokinase proteins in several other organisms; e.g. residues 1-404 are 63% similar to 12229624 of Pseudomonas aeruginosa.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0527
COG name: Aspartokinases
Functional Class:  E
The phylogenetic pattern of COG0527 is amtKyqVcEBrHuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001341 (Aspartokinase, N-terminus) with a combined E-value of 1.4e-57.
    IPB001341A    3-15
    IPB001341B    38-48
    IPB001341C    73-83
    IPB001341D    146-179
    IPB001341E    376-402
***** IPB001057 (Glutamate 5-kinase) with a combined E-value of 4.3e-07.
    IPB001057A    19-44
    IPB001057C    150-183


ProDom Summary:  Protein Domain Search
Residues 249-404 are 51% similar to a (KINASE BIOSYNTHESIS ASPARTOKINASE) protein domain (PD001427) which is seen in AK_HELPY.

Residues 68-233 are 53% similar to a (KINASE TRANSFERASE BIOSYNTHESIS) protein domain (PD000447) which is seen in AK2_BACSU.

Residues 1-67 are 49% similar to a (BIOSYNTHESIS ASPARTOKINASE KINASE TRANSFERASE ASPARTATE) protein domain (PD002283) which is seen in AK2_BACSU.



Paralogs:  Local Blast Search


NG0956 is paralogously related to NG1973 (uridylate kinase (PyrH)) (1e-08) and NG0849 (gamma-glutamyl kinase) (4e-07).


Pfam Summary:  Pfam Search
Residues 2 to 230 (E-value = 1.1e-74) place NG0956 in the AA_kinase family which is described as Amino acid kinase family (PF00696)
Residues 264 to 335 (E-value = 2.8e-08) place NG0956 in the ACT family which is described as ACT domain (PF01842)
Residues 345 to 404 (E-value = 5.8e-07) place NG0956 in the ACT family which is described as ACT domain (PF01842)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MALIVHKYGGTSVGSPERIKNVAKRVAKARAEGHDIVVVVSAMSGETNRL
VALAHEMQEHPDPRELDVVLATGEQVTIGLLAMALKDIGVDAKSYTGWQV
SLKTDTAHTKARIESIDDEKMRADLAAGKVVIVAGFQGISSEGNISTLGR
GGSDTSAVALAAALKADECQIYTDVDGVYTTDPRVVPEARRMDTVTFEEM
IELASLGSKVLQIRSVEFAGKYKVRLRVLSSLQDGGNGTLITFEEDDNME
RAAVTGIAFDKNQARINVRGVPDKPGVAYQILGAVADANIEVDMIIQNVG
SEGTTDFSFTVPRGDYKQTLEILSERKDSIGAASIDGDDTVCKVSAVGLG
MRSHVGVAAKIFRTLAEEGINIQMISTSEIKVSVLIDEKYMELATRVLHK
AFDLG

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGTTAATCGTACATAAATACGGCGGCACATCCGTAGGCTCGCCCGA
GCGCATTAAAAACGTGGCCAAACGTGTCGCTAAAGCCCGCGCCGAAGGAC
ACGATATCGTCGTCGTCGTATCCGCCATGAGCGGCGAAACCAACCGTCTG
GTTGCGTTGGCGCACGAAATGCAGGAGCATCCCGATCCGCGCGAGCTGGA
CGTCGTCTTAGCTACCGGCGAACAAGTAACCATCGGCCTTTTGGCAATGG
CATTGAAGGATATCGGCGTGGATGCCAAAAGCTACACAGGCTGGCAGGTC
TCCCTCAAAACCGATACCGCCCACACCAAAGCCCGCATAGAAAGCATTGA
TGACGAAAAAATGCGCGCCGACCTCGCCGCCGGCAAAGTCGTCATCGTTG
CCGGCTTCCAAGGCATCAGCAGTGAAGGCAATATTTCCACGCTAGGACGC
GGCGGTTCCGACACTTCCGCCGTTGCGCTTGCCGCAGCCCTCAAAGCGGA
CGAATGCCAAATCTATACCGACGTAGACGGCGTTTACACCACCGACCCCC
GCGTCGTACCCGAAGCGCGCCGTATGGATACGGTTACATTTGAAGAAATG
ATCGAACTGGCCAGCCTCGGTTCGAAAGTTTTGCAAATCCGTTCAGTAGA
ATTCGCCGGAAAATACAAAGTGCGCCTGCGCGTACTGAGCAGCCTGCAAG
ACGGCGGCAACGGCACCTTAATTACCTTTGAAGAGGACGACAACATGGAA
AGAGCTGCCGTAACCGGTATCGCATTCGATAAAAACCAAGCCCGCATCAA
CGTGCGCGGTGTGCCCGATAAGCCCGGCGTCGCCTATCAGATTTTGGGCG
CGGTCGCAGATGCCAACATCGAAGTCGATATGATTATCCAAAATGTCGGC
AGCGAAGGCACAACCGATTTTTCTTTCACCGTACCGCGCGGCGATTACAA
ACAGACTTTGGAAATCCTGTCGGAACGTAAAGACAGTATCGGCGCAGCTT
CTATCGACGGCGACGACACCGTGTGCAAAGTCTCCGCAGTCGGTTTGGGT
ATGCGTTCGCACGTCGGCGTAGCCGCCAAAATCTTCCGCACGCTCGCCGA
AGAGGGCATCAACATCCAAATGATTTCCACCTCCGAAATCAAAGTTTCCG
TATTGATTGACGAAAAATACATGGAACTGGCAACCAGGGTATTGCATAAA
GCCTTTGATTTGGGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy