Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0783 IGR0786 IGR0782.1 IGR0784 IGR0782.2 IGR0785 pip, - NG0949 NG0944 NG0953 spoU,trmH, - NG0943 dapA, - NG0947 NG0948 NG0952 pip, - NG0949 NG0944 NG0953 spoU,trmH, - NG0943 dapA, - NG0947 NG0948 NG0952 Type: tandem, Name:  - 38 Type: tandem, Name:  - 39 Type: direct, Name:  - 129 pip, - NG0949 NG0944 NG0950 NG0945 NG0950 NG0945 NG0953 spoU,trmH, - NG0943 dapA, - NG0947 NG0948 NG0952
* Calculated from Protein Sequence

Gene ID: NG0949

DNA Molecule Name:
1  

Genbank ID:
1073191

Gene Name:
pip  

Definition:
proline iminopeptidase Pip

Gene Start:
924512

Gene Stop:
923583

Gene Length:
930

Molecular Weight*:
34778

pI*:
5.20

Net Charge*:
-10.90

EC:
3.4.11.5  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Arginine and proline metabolism

Primary Evidence:
Albertson,N.H. and Koomey,M.,
Molecular cloning and characterization of a proline iminopeptidase gene from Neisseria gonorrhoeae,
Mol.Microbiol.9 (6), 1203-1211 (1993)
Medline: 95020651


Secondary Evidence:
Kabashima,T., Kitazono,A., Kitano,A., Ito,K. and Yoshimoto,T.
Prolyl aminopeptidase from Serratia marcescens: cloning of the
enzyme gene and crystallization of the expressed enzyme
J. Biochem. 122 (3), 601-605 (1997)
Medline: 98006313

Ito,K., Inoue,T., Kabashima,T., Kanada,N., Huang,H.S., Ma,X.,
Azmi,N., Azab,E. and Yoshimoto,T.
Substrate recognition mechanism of prolyl aminopeptidase from
Serratia marcescens
J.Biochem.128 (4), 673-678 (2000)
Medline: 20467422

Yoshimoto,T., Kabashima,T., Uchikawa,K., Inoue,T., Tanaka,N.,
Nakamura,K.T., Tsuru,M. and Ito,K.
Crystal structure of prolyl aminopeptidase from Serratia marcescens
J.Biochem.126 (3), 559-565 (1999)
Medline: 99398435

Sudo,T., Shinohara,K., Dohmae,N., Takio,K., Usami,R., Horikoshi,K.
and Osada,H.
Isolation and characterization of the gene encoding an
aminopeptidase involved in the selective toxicity of ascamycin
toward Xanthomonas campestris pv. citri
Biochem.J.319 (Pt 1), 99-102 (1996)
Medline: 97024426




Comment:
Oklahoma ID: NGO.949c

Blast Summary:  PSI-Blast Search
NG0949 is 100% identical to a previously sequenced Neisseria gonorrhoeae protein in GenBank, 396840.

Residues 1-310 are 97% similar to proline iminopeptidase from Neisseria meningitidis group B strain MD58 (12230405|).

Numerous hits in gapped BLAST to proline iminopeptidase sequences,e.g.residues 1-310 are 49% similar to prolyl aminopeptidase from Pseudomonas aeruginosa strain PAO1 (11352421).

COGS Summary:  COGS Search
BeTs to 5 clades of COG0596
COG name: Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)
Functional Class:  R
The phylogenetic pattern of COG0596 is A---Yq-CEBR-ujgp----X
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR00793 (Prolyl aminopeptidase (S33) family signature) with a combined E-value of 1.5e-20.
    PR00793A    34-42
    PR00793B    60-71
    PR00793C    103-117
***** PR00412 (Epoxide hydrolase signature) with a combined E-value of 8.6e-08.
    PR00412B    57-72
    PR00412C    103-116
    PR00412D    117-130
    PR00412E    250-266
***** PR00111 (Alpha/beta hydrolase fold signature) with a combined E-value of 1.5e-07.
    PR00111A    57-72
    PR00111B    103-116
    PR00111C    117-130
    PR00111D    252-266


ProDom Summary:  Protein Domain Search
Residues 34-173 are 30% similar to a (AMINOPEPTIDASE PROLINE IMINOPEPTIDASE PROLYL PLASMID) protein domain (PD023969) which is seen in O33480_PROFR.

Residues 4-152 are 31% similar to a (HYPOTHETICAL 32.6 KD PROTEIN) protein domain (PD092968) which is seen in O05293_MYCTU.

Residues 246-303 are 62% similar to a (AMINOPEPTIDASE PROLYL PROLINE IMINOPEPTIDASE HYDROLASE) protein domain (PD186995) which is seen in P93732_ARATH.

Residues 29-129 are identical to a (HYDROLASE PROTEIN EPOXIDE LIPASE PUTATIVE ESTERASE) protein domain (PD000150) which is seen in PIP_NEIGO.

Residues 1-28 are identical to a (PROLINE IMINOPEPTIDASE EC 3.4.11.5) protein domain (PD206546) which is seen in PIP_NEIGO.

Residues 130-243 are identical to a (AMINOPEPTIDASE PROLINE IMINOPEPTIDASE PROLYL HYDROLASE) protein domain (PD011214) which is seen in PIP_NEIGO.

Residues 244-290 are identical to a (HYDROLASE PROTEIN ESTERASE 4-DIENOATE AROMATIC) protein domain (PD000433) which is seen in PIP_NEIGO.



Paralogs:  Local Blast Search


NG0949 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 58 to 307 (E-value = 3.7e-50) place NG0949 in the Abhydrolase_1 family which is described as alpha/beta hydrolase fold (PF00561)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1QTR|1QTR-A CRYSTAL STRUCTURE ANALYSIS OF THE PROLYL 312.0 4e-86
pdb|1AZW|1AZW-A PROLINE IMINOPEPTIDASE FROM XANTHOMONAS 306.0 4e-84
pdb|1BN6|1BN6-A HALOALKANE DEHALOGENASE FROM A RHODOCOCCUS 47.3 4e-06
pdb|1CQW|1CQW-A NAI

Gene Protein Sequence:
MYEIKQPFHSGYLQVSEIHQIYWEESGNPDGVPVIFLHGGPGAGASPECR
GFFNPDVFRIVIIDQRGCGRSHPYACAEDNTTWDLVADIEKVREMLGIGK
WLVFGGSWGSTLSLAYAQTHPERVKGLVLRGIFLCRPSETAWLNEAGGVS
RIYPEQWQKFVAPIAENRRNRLIEAYHGLLFHQDEEVCLSAAKAWADWES
YLIRFEPEGVDEDAYASLAIARLENHYFVNGGWLQGDKAILNNIGKIRHI
PTVIVQGRYDLCTPMQSAWELSKAFPEAELRVVQAGHCAFDPPLADALVQ
AVEDILPRLL

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATGAAATAAAACAGCCTTTTCATAGCGGATACTTGCAGGTGTCTGA
AATTCATCAAATTTATTGGGAAGAGTCGGGCAATCCCGACGGTGTGCCGG
TCATTTTTTTACACGGCGGGCCGGGCGCGGGGGCTTCGCCTGAATGTCGG
GGTTTTTTCAATCCTGATGTGTTCCGCATCGTCATCATCGACCAGCGCGG
TTGCGGACGTTCGCACCCGTATGCTTGTGCGGAAGACAATACGACTTGGG
ATTTGGTGGCGGATATTGAAAAAGTCCGTGAAATGCTGGGTATCGGGAAA
TGGCTGGTGTTCGGCGGTTCGTGGGGCAGCACTTTGTCGCTGGCTTATGC
CCAAACCCATCCCGAACGGGTAAAGGGATTGGTGTTGCGCGGGATATTTT
TGTGCAGGCCGTCTGAAACGGCGTGGCTGAACGAGGCGGGCGGCGTGAGC
CGGATTTATCCGGAACAATGGCAAAAATTTGTCGCGCCGATTGCTGAAAA
TCGGCGGAACCGGCTGATTGAGGCGTATCACGGGTTGCTGTTTCATCAAG
ATGAAGAAGTGTGCCTGTCTGCCGCGAAGGCTTGGGCGGATTGGGAAAGC
TATCTGATTCGTTTCGAGCCGGAGGGAGTGGATGAAGATGCTTATGCCTC
ACTGGCAATCGCGCGTTTGGAAAACCATTATTTTGTCAACGGCGGTTGGT
TGCAGGGTGATAAGGCGATTTTGAACAATATCGGCAAAATACGGCATATC
CCGACCGTTATCGTGCAGGGGCGGTATGATTTGTGTACGCCTATGCAGAG
TGCGTGGGAGCTGTCGAAAGCCTTTCCCGAAGCGGAATTGAGGGTGGTCC
AGGCGGGGCATTGTGCGTTCGATCCGCCTTTGGCGGATGCGTTGGTTCAG
GCGGTTGAGGATATTTTGCCCCGTTTGTTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy