Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0780 IGR0781 IGR0779 IGR0783 IGR0778 IGR0782.1 IGR0777 IGR0784 IGR0782 IGR0782.2 NG0938 NG0939 efp, - NG0936 pip, - NG0949 NG0944 NG0937 NG0942 yfhC, - NG0941 spoU,trmH, - NG0943 dapA, - NG0947 miaA, - NG0940 NG0948 NG0938 NG0939 efp, - NG0936 pip, - NG0949 NG0944 NG0937 NG0942 yfhC, - NG0941 spoU,trmH, - NG0943 dapA, - NG0947 miaA, - NG0940 NG0948 NG0939 efp, - NG0936 pip, - NG0949 NG0944 NG0937 NG0945 NG0945 NG0938 NG0942 yfhC, - NG0941 spoU,trmH, - NG0943 dapA, - NG0947 miaA, - NG0940 NG0948
* Calculated from Protein Sequence

Gene ID: NG0943

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
spoU  trmH  

Definition:
possible tRNA/rRNA methyltransferase

Gene Start:
918875

Gene Stop:
919648

Gene Length:
774

Molecular Weight*:
30122

pI*:
12.30

Net Charge*:
42.00

EC:
2.1.1.34  

Functional Class:
Transcription; RNA synthesis, modification, and DNA transcription  
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table

Secondary Evidence:
Anantharaman V, Koonin EV, Aravind L.
SPOUT: a class of methyltransferases that includes spoU and trmD RNA methylase superfamilies, and novel superfamilies of predicted prokaryotic RNA methylases.
J Mol Microbiol Biotechnol. 2002 Jan;4(1):71-5.
PMID: 11763972

Persson BC, Jäger G, Gustafsson C.
The spoU gene of Escherichia coli, the fourth gene of the spoT operon, is essential for tRNA (Gm18) 2'-O-methyltransferase activity.
Nucleic Acids Res. 1997 Oct;25(20):4093-7.
PMID: 9321663

Koonin EV, Rudd KE.
SpoU protein of Escherichia coli belongs to a new family of putative rRNA methylases.
Nucleic Acids Res. 1993 Nov;21(23):5519.
PMID: 8265370

Comment:


Blast Summary:  PSI-Blast Search
Residues 7-113 are 37% similar to hypothetical tRNA/rRNA methyltransferase.

Residues 7-112 are 35% similar to hypothetical tRNA/rRNA methyltransferase.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0566
COG name: rRNA methylases
Functional Class:  J
The phylogenetic pattern of COG0566 is a---YQvCEBRHujgpOLinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


NG0943 is paralogously related to NG0512 (hypothetical protein) (3e-04).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|1GZ0|1GZ0-A 23S RIBOSOMAL RNA G2251 2'O-METHYLTRANSFERASE 80.8 3e-16

Gene Protein Sequence:
MANQRPIYGFHAVNARLWQNPKSITELYIQEGKSDARTREVLEKAANENI
RVYFADADRLNAISKGARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLI
LDGITDPHNLGACPAYRRRNGRTRRHRAERQKRGTERHRQQSRLRRGGNR
PLHHRNQPRPHPARIERIRHLDHRHRHGRRRRPLPLQSARQHGVGDGQRR
RRYAPPHARTLRHAGVHTHVRHGRKHERLRVRRNGIKRNPPATRIEKQKS
VSLKNNAV

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAAACCAAAGACCCATCTACGGCTTCCACGCCGTCAACGCCCGATT
GTGGCAAAACCCCAAATCGATTACCGAACTCTATATCCAAGAAGGCAAAT
CCGACGCACGCACGCGCGAAGTGCTGGAAAAGGCGGCAAACGAAAACATC
CGCGTATATTTTGCCGATGCCGACCGCCTCAACGCCATCAGCAAAGGCGC
GCGCCATCAGGGCGTGGTCGGATTTATCGATGCCTCCAAAAACCACGTCC
ACCTCGAAGACGTATTGGAAAACTTGAGCGAACCGCCGCTGCTGCTGATA
CTCGACGGCATCACCGATCCGCACAACCTCGGCGCGTGCCCTGCGTACCG
CCGACGCAATGGGCGTACACGCCGTCATCGCGCCGAAAGACAAAAGCGCG
GGACTGAACGCCACCGTCAGCAAAGTCGCCTGCGGCGCGGCGGAAACCGT
CCCCTACATCACCGTAACCAACCTCGCCCGCACCCTGCGCGAATTGAAAG
AATACGGCATTTGGATCATCGGCACCGACATGGGCGGCGACGCCGACCTT
TACCATTGCAATCTGCCCGACAGCACGGCGTGGGTGATGGGCAACGAAGG
CGACGGTATGCGCCGCCTCACGCGCGAACATTGCGACATGCTGGTGTCCA
TACCCATGTTCGGCACGGTCGAAAGCATGAACGTCTCCGTGTCCGCAGGA
ATGGTATTAAGCGAAACCCGCCGGCAACGCGTATTGAAAAACAAAAAAGC
GTAAGCCTCAAAAACAATGCCGTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy