Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0780 IGR0781 IGR0779 IGR0783 IGR0778 IGR0782.1 IGR0777 IGR0776.1 IGR0782 IGR0776 IGR0782.2 NG0938 NG0939 efp, - NG0936 NG0944 NG0937 NG0942 NG0934 yfhC, - NG0941 NG0935 spoU,trmH, - NG0943 dapA, - NG0947 miaA, - NG0940 NG0948 NG0938 NG0939 efp, - NG0936 NG0944 NG0937 NG0942 NG0934 yfhC, - NG0941 NG0935 spoU,trmH, - NG0943 dapA, - NG0947 miaA, - NG0940 NG0948 NG0939 efp, - NG0936 NG0944 NG0937 NG0945 NG0945 NG0938 NG0942 yfhC, - NG0941 NG0935 spoU,trmH, - NG0943 dapA, - NG0947 miaA, - NG0940 NG0948 NG0934
* Calculated from Protein Sequence

Gene ID: NG0941

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yfhC  

Definition:
cytosine deaminase

Gene Start:
917597

Gene Stop:
918313

Gene Length:
717

Molecular Weight*:
25903

pI*:
8.10

Net Charge*:
4.11

EC:
3.5.4.1  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Pyrimidine metabolism

Comment:
The entire sequence of this protein only hit to one protein of similar length using gapped BLAST. All other hits corresponded to the ~150 C-terminal amino acids of NG0941.

Oklahoma ID: NGO.941

Blast Summary:  PSI-Blast Search
NG0941 is orthologous to AE002444, N. meningitidis MC58 cytidine and deoxycytidylate deaminase family protein : residues 1-239 have
95% similarity to residues 1-239 in NG0941.

NG0941 also had significant similarity to cytosine deaminase proteins in many other organisms; e.g. residues 86-238 are 45% similar to 11356318 of Vibrio cholerae.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0590
COG name: Cytosine deaminase-related enzymes
Functional Class:  F
The phylogenetic pattern of COG0590 is ----Yq-CeBRh------inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 141-190 are 62% similar to a (PROTEIN DEAMINASE HYDROLASE ZINC) protein domain (PD001793) which is seen in YFHC_ECOLI.



Paralogs:  Local Blast Search


NG0941 is paralogously related to NG0089 (riboflavin biosynthesis protein RibD) (1e-06).


Pfam Summary:  Pfam Search
Residues 5 to 77 (E-value = 5.5e-06) place NG0941 in the TfoX_C family which is described as TfoX C-terminal domain (PF04994)
Residues 90 to 190 (E-value = 3.9e-35) place NG0941 in the dCMP_cyt_deam family which is described as Cytidine and deoxycytidylate deaminase zinc-binding region (PF00383)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MLATPPLAPKTVAALHRLGIRTLEELRQNGSVKAFLLLKASGLTLTKSTL
WQLESLLNGTPPQEMSQAHKDCLLAELKNHPPVAAFPPQEEMGYFMREAL
RQAEQSAADGEIPVGAVIVSDGKIITSAHNTCIADCNVSRHAEINALAQA
GSEMQNYRLDGCDIYITLEPCAMCASALIQARIRRVIYGAAEPKTGAAGS
IVNLFADKRLNTHTAIRGGILQEECRAVLSRFFQNKRKG

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTGGCCACGCCGCCGCTCGCCCCCAAAACCGTCGCCGCCCTGCACAG
GCTCGGTATCCGTACGCTCGAAGAACTGCGGCAAAACGGTTCGGTCAAAG
CCTTTCTGCTGCTCAAAGCATCGGGTTTGACCCTCACGAAAAGCACGCTG
TGGCAACTCGAGTCGCTGCTGAACGGCACGCCGCCGCAAGAAATGTCCCA
AGCGCATAAAGACTGCCTGCTTGCCGAGTTGAAAAACCATCCGCCCGTCG
CCGCCTTTCCGCCGCAGGAAGAAATGGGATACTTCATGCGCGAAGCACTG
CGCCAAGCAGAACAATCCGCCGCCGACGGCGAAATACCCGTCGGGGCAGT
CATCGTTTCAGACGGCAAAATCATCACATCGGCACACAACACCTGCATTG
CCGACTGCAATGTCAGCCGACACGCCGAAATCAACGCCTTGGCACAGGCA
GGCAGCGAAATGCAAAACTACCGCCTTGACGGATGCGACATCTACATCAC
CCTCGAACCCTGCGCCATGTGCGCGTCCGCACTGATACAGGCACGAATCA
GGCGCGTGATCTACGGTGCGGCAGAACCCAAAACCGGCGCGGCAGGCAGC
ATCGTCAACCTGTTTGCCGACAAACGCCTCAATACGCACACCGCCATACG
GGGCGGAATCCTGCAAGAAGAATGCCGCGCCGTATTAAGCCGTTTTTTCC
AAAACAAAAGAAAAGGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy