Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0766 IGR0764 IGR0771 IGR0768 IGR0767 IGR0765 IGR0770 IGR0763 IGR0762 IGR0769 NG0927 NG0924 NG0919 dhsC, - NG0923 sdhB,dhsB, - NG0920 prxII, - NG0926 cisY,gltA, - NG0918 dldH, - NG0925 dhsA,sdhA, - NG0921 metE, - NG0928 sucA, - NG0917 NG0927 NG0924 NG0919 dhsC, - NG0923 sdhB,dhsB, - NG0920 prxII, - NG0926 cisY,gltA, - NG0918 dldH, - NG0925 dhsA,sdhA, - NG0921 metE, - NG0928 sucA, - NG0917 NG0919 sdhB,dhsB, - NG0920 prxII, - NG0926 cisY,gltA, - NG0918 dldH, - NG0925 dhsA,sdhA, - NG0921 metE, - NG0928 sucA, - NG0917 dhsD, - NG0922 dhsC, - NG0923 NG0927 dhsD, - NG0922 NG0924
* Calculated from Protein Sequence

Gene ID: NG0921

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dhsA  sdhA  

Definition:
succinate dehydrogenase flavoprotein subunit

Gene Start:
903420

Gene Stop:
901660

Gene Length:
1761

Molecular Weight*:
64441

pI*:
6.20

Net Charge*:
-9.45

EC:
1.3.99.1  

Functional Class:
Energy metabolism; TCA cycle  

Pathway: pathway table
Butanoate metabolism
Citrate cycle (TCA cycle)
Electron Transport System, Complex II
Oxidative phosphorylation
Reductive carboxylate cycle (CO2 fixation)

Secondary Evidence:
Aliabadi,Z., Winkler,H.H. and Wood,D.O. Isolation and characterization of the Rickettsia prowazekii gene encoding the flavoprotein subunit of succinate dehydrogenase. Gene 133 (1): 135-140 (1993) [Medline: 94040788].

Heinzen,R.A., Mo,Y.Y., Robertson,S.J. and Mallavia,L.P. Characterization of the succinate dehydrogenase-encoding gene cluster (sdh) from the rickettsia Coxiella burnetii. Gene 155 (1): 27-34 (1995) [Medline: 95212926].

Wood,D., Darlison,M.G., Wilde,R.J. and Guest,J.R. Nucleotide sequence encoding the flavoprotein and hydrophobic subunits of the succinate dehydrogenase of Escherichia coli. Biochem. J. 222 (2): 519-534 (1984) [Medline: 84307466].

Comment:
From GenBANK (gi:2506437): Two distinct, membrane-bound, FAD-containing enzymes are responsible for the catalysis of fumarate and succinate interconversion; the fumarate reductase is used in anaerobic growth, and the succinate dehydrogenase is used in aerobic growth. This protein catalyzes the reaction: (succinate + acceptor = fumarate + reduced acceptor) of the tricarboxylic acid cycle. It is part of an enzyme complex containing four subunits: a flavoprotein, an iron-sulfur, cytochrome B-556, and an hydrophobic anchor protein. It is membrane-bound.

See also: NG0920, iron-sulfur subunit; NG0922, hydrophobic membrane anchor subunit; and NG0923, the cytochrome B-556 subunit.

Oklahoma ID: NGO.921c

Blast Summary:  PSI-Blast Search
NG0921 is orthologous to AE002446, N. meningitidis MC58 succinate dehydrogenase, flavoprotein subunit : residues 1-587 have similarity to residues 1-587 in NG0921.

NG0921 also has strong hits (P-value < 1e-100) to succinate dehydrogenase, flavoprotein subunit proteins in several organisms outside of Neisseria; e.g. residues 8-587 are 54% similar to 11352598 of Pseudomonas aeruginosa.

COGS Summary:  COGS Search
BeTs to 12 clades of COG1053
COG name: Succinate dehydrogenase/fumarate reductase, flavoprotein subunits
Functional Class:  C
The phylogenetic pattern of COG1053 is Amt-YqvcEbRhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003952 (Fumarate reductase / succinate dehydrogenase FAD-binding site) with a combined E-value of 4.5e-242.
    IPB003952A    9-23
    IPB003952B    30-59
    IPB003952C    63-78
    IPB003952D    93-121
    IPB003952E    133-150
    IPB003952F    219-269
    IPB003952G    311-362
    IPB003952H    381-412
    IPB003952I    442-494
    IPB003952J    509-549
***** IPB000447 (FAD-dependent glycerol-3-phosphate dehydrogenase) with a combined E-value of 4.1e-07.
    IPB000447A    8-60
    IPB000447C    187-209
***** PR00368 (FAD-dependent pyridine nucleotide reductase signature) with a combined E-value of 1.2e-06.
    PR00368A    9-31
    PR00368B    198-207
    PR00368E    382-389


ProDom Summary:  Protein Domain Search
Residues 108-421 are 67% similar to a (FLAVOPROTEIN SUBUNIT OXIDOREDUCTASE FAD DEHYDROGENASE) protein domain (PD001219) which is seen in O83001_RHOFE.

Residues 458-551 are 53% similar to a (FLAVOPROTEIN SUBUNIT DEHYDROGENASE OXIDOREDUCTASE) protein domain (PD001222) which is seen in DHSA_PARDE.

Residues 34-106 are 75% similar to a (FLAVOPROTEIN SUBUNIT OXIDOREDUCTASE DEHYDROGENASE) protein domain (PD149640) which is seen in DHSA_ECOLI.



Paralogs:  Local Blast Search


NG0921 is paralogously related to NG1568 (L-aspartate oxidase (NadB)) (5e-59).


Pfam Summary:  Pfam Search
Residues 108 to 439 (E-value = 2.9e-197) place NG0921 in the FAD_binding_2 family which is described as FAD binding domain (PF00890)
Residues 459 to 587 (E-value = 2.5e-68) place NG0921 in the Succ_DH_flav_C family which is described as Fumarate reductase/succinate dehydrogenase flavoprotein C-terminal domain (PF02910)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
505  
534

PDB Hit:
pdb|1KF6|1KF6-A E. COLI QUINOL-FUMARATE REDUCTASE WITH BOUND 364.0 0e+00
pdb|1QLA|1QLA-A RESPIRATORY COMPLEX II-LIKE FUMARATE REDUCTASE 300.0 3e-82
pdb|1E7P|1E7P-G QUINOL:FUMARATE REDUCTASE FROM WOLINELLA 300.0 3e-82
pdb|1E7P|1E7P-A QUIN

Gene Protein Sequence:
MGFPVRKFDAVIVGGGGAGLRAALQLSKSGLNCAVLSKVFPTRSHTVAAQ
GGISASLGNVQEDRWDWHMYDTVKGSDWLGDQDAIEFMCRAAPEAVIELE
HMGMPFDRVESGKIYQRPFGGHTAEHGKRAVERACAVADRTGHAMLHTLY
QQNVRANTQFFVEWTAQDLIRDENGDVVGVTAMEMETGEVYIFHAKAVMF
ATGGGGRIYASSTNAYMNTGDGLGICARAGIPLEDMEFWQFHPTGVAGAG
VLITEGVRGEGGILLNADGERFMERYAPTVKDLASRDVVSRAMAMEIYEG
RGCGKNKDHVLLKIDHIGAEKIMEKLPGIREISIQFAGIDPIKDPIPVVP
TTHYMMGGIPTNYHGEVVVPQGDEYEVPVKGLYAAGECACASVHGANRLG
TNSLLDLVVFGKAAGDSMIKFIKEQSDWKPLPANAGELTRQRIERLDSQT
DGENVDALRRELQRSVQLHAGVFRTDEILSKGVQEIMAIAERVKRTEIKD
KSKVWNTARIEALELDNLIEVAKATLVSAEARKESRGAHASDDHPERDDE
NWMKHTLYHSDTNTLSYKPVHTKPLSVEYIKPAKRVY

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTTTTCCTGTTCGCAAGTTTGATGCCGTGATTGTCGGCGGTGGCGG
TGCAGGTTTACGTGCAGCCCTCCAATTATCCAAATCCGGTTTGAATTGTG
CCGTTTTGTCTAAAGTGTTCCCGACCCGCTCGCATACCGTAGCGGCGCAG
GGCGGTATTTCCGCCTCTCTGGGTAATGTGCAGGAGGACCGTTGGGACTG
GCACATGTACGATACCGTGAAAGGTTCCGACTGGCTGGGCGACCAAGATG
CGATTGAGTTTATGTGTCGCGCTGCGCCTGAAGCGGTGATTGAGTTGGAA
CACATGGGTATGCCTTTTGACCGCGTTGAAAGCGGCAAAATTTATCAGCG
TCCTTTCGGCGGACATACTGCCGAACATGGTAAACGTGCGGTAGAACGTG
CATGTGCGGTTGCCGACCGTACCGGTCATGCGATGTTGCATACTTTGTAC
CAACAAAACGTCCGTGCCAATACACAATTCTTTGTGGAATGGACGGCGCA
AGATTTGATTCGTGATGAAAACGGCGATGTCGTCGGCGTAACCGCCATGG
AAATGGAAACGGGCGAAGTTTATATTTTCCACGCCAAGGCCGTGATGTTT
GCTACCGGTGGCGGCGGTCGTATTTATGCTTCTTCTACCAATGCTTATAT
GAATACCGGTGACGGTTTGGGCATTTGCGCCCGTGCGGGCATTCCGTTGG
AAGATATGGAATTCTGGCAATTCCACCCGACCGGCGTGGCGGGTGCGGGC
GTGTTGATTACCGAAGGCGTACGCGGCGAGGGCGGTATTCTGTTGAACGC
CGACGGCGAACGCTTTATGGAACGCTATGCGCCGACCGTAAAAGACTTGG
CTTCTCGCGACGTGGTTTCACGCGCGATGGCGATGGAAATCTATGAAGGT
CGCGGCTGTGGTAAAAACAAAGACCACGTCTTACTGAAAATCGACCATAT
CGGTGCAGAAAAAATTATGGAAAAACTGCCGGGCATCCGCGAGATTTCCA
TTCAGTTTGCCGGTATCGATCCGATTAAAGACCCGATTCCGGTTGTGCCG
ACTACCCACTATATGATGGGCGGCATTCCGACCAATTATCACGGTGAAGT
TGTTGTTCCGCAAGGCGACGAGTACGAAGTACCTGTAAAAGGCCTGTATG
CCGCAGGTGAGTGCGCCTGTGCTTCCGTACACGGTGCGAACCGTTTGGGT
ACGAACTCCCTGCTGGACTTGGTGGTGTTCGGCAAAGCTGCCGGTGACAG
CATGATTAAATTCATCAAAGAGCAAAGCGATTGGAAACCTCTGCCTGCTA
ATGCCGGTGAGTTGACCCGCCAACGTATCGAGCGTTTGGACAGTCAAACC
GATGGTGAAAACGTTGATGCATTGCGTCGCGAACTGCAACGCTCCGTACA
ACTGCACGCCGGCGTGTTCCGTACCGATGAGATTCTGAGCAAAGGCGTTC
AAGAAATCATGGCGATTGCCGAGCGTGTGAAACGTACCGAAATCAAAGAC
AAGAGCAAAGTGTGGAATACCGCGCGTATCGAAGCTTTGGAATTGGATAA
CCTGATTGAAGTGGCGAAAGCGACTTTGGTGTCTGCCGAAGCACGTAAAG
AATCACGCGGTGCGCACGCTTCAGACGACCATCCTGAGCGCGATGACGAA
AATTGGATGAAACACACCCTGTATCATTCGGACACCAATACCTTGTCTTA
CAAACCGGTACACACCAAGCCTTTGAGCGTGGAATACATCAAACCGGCCA
AACGCGTTTAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy