Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0766 IGR0764 IGR0768 IGR0767 IGR0765 IGR0763 IGR0762 IGR0769 NG0924 NG0919 dhsC, - NG0923 sdhB,dhsB, - NG0920 prxII, - NG0926 cisY,gltA, - NG0918 dldH, - NG0925 dhsA,sdhA, - NG0921 sucA, - NG0917 NG0924 NG0919 dhsC, - NG0923 sdhB,dhsB, - NG0920 prxII, - NG0926 cisY,gltA, - NG0918 dldH, - NG0925 dhsA,sdhA, - NG0921 sucA, - NG0917 sdhB,dhsB, - NG0920 prxII, - NG0926 cisY,gltA, - NG0918 dldH, - NG0925 dhsA,sdhA, - NG0921 sucA, - NG0917 dhsD, - NG0922 dhsC, - NG0923 NG0919 dhsD, - NG0922 NG0924
* Calculated from Protein Sequence

Gene ID: NG0920

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sdhB  dhsB  

Definition:
succinate dehydrogenase, iron-sulfur protein

Gene Start:
901558

Gene Stop:
900833

Gene Length:
726

Molecular Weight*:
27930

pI*:
7.90

Net Charge*:
3.20

EC:
1.3.99.1  

Functional Class:
Energy metabolism; TCA cycle  

Pathway: pathway table
Butanoate metabolism
Citrate cycle (TCA cycle)
Electron Transport System, Complex II
Oxidative phosphorylation
Reductive carboxylate cycle (CO2 fixation)

Primary Evidence:
Goodman,S.D. and Scocca,J.J.
Identification and arrangement of the DNA sequence recognized in
specific transformation of Neisseria gonorrhoeae
Proc. Natl. Acad. Sci. U.S.A. 85 (18), 6982-6986 (1988)
Medline: 88320560


Secondary Evidence:
Darlison,M.G. and Guest,J.R.
Nucleotide sequence encoding the iron-sulphur protein subunit of
the succinate dehydrogenase of Escherichia coli
Biochem. J. 223 (2), 507-517 (1984)
Medline: 85046453

Darlison,M.G., Spencer,M.E. and Guest,J.R.
Nucleotide sequence of the sucA gene encoding the 2-oxoglutarate
dehydrogenase of Escherichia coli K12
Eur.J.Biochem. 141 (2), 351-359 (1984)
Medline: 84236168



Comment:
From GenBANK (gi:118615): Two distinct, membrane-bound, FAD-containing enzymes are responsible for the catalysis of fumarate and succinate interconversion; the fumarate reductase is used in anaerobic growth, and the succinate dehydrogenase is used in aerobic growth. The reaction: succinate + acceptor = fumarate + reduced acceptor. This requires the binding of three different iron-sulfur clusters: a 2Fe-2S, a 3Fe-4S and a 4Fe-4S. It is involved in the tricarboxylic acid cycle. It is part of an enzyme complex containing four subunits: a flavoprotein, an iron-sulfur, cytochrome B-556, and an hydrophobic anchor protein. The iron-sulfur centers are similar to those of 'plant-type' 2Fe-2S and 'bacterial-type' 4Fe-4S ferredoxins.

See also: NG0921, flavoprotein subunit; NG0922, hydrophobic membrane anchor subunit; and NG0923, the cytochrome B-556 subunit.

Oklahoma ID: NGO.920c

Blast Summary:  PSI-Blast Search
NG0920 is 96% identical to a previously sequenced Neisseria gonorrhoeae protein in GenBank, 150368.

Residues 8-242 are 99% similar to succinate dehydrogenase, iron-sulfur protein from Neisseria meningitidis group B strain MD58,group A strain Z2491 (11252625|).

Numerous hits in gapped BLAST to succinate dehydrogenase iron-sulfur protein sequences,e.g.residues 10-240 are 65% similar to succinate dehydrogenase iron-sulfur protein from Escherichia coli K12 (1786943|).Residues 11-239 are 64% similar to succinate dehydrogenase from Pseudomonas aeruginosa strain PAO1 (11352599|).




COGS Summary:  COGS Search
BeTs to 12 clades of COG0479
COG name: Succinate dehydrogenase/fumarate reductase Fe-S protein
Functional Class:  C
The phylogenetic pattern of COG0479 is amt-yQ-CEbRhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 50-142 are 97% similar to a (IRON-SULFUR DEHYDROGENASE PROTEIN) protein domain (PD001472) which is seen in Q51072_NEIGO.

Residues 143-240 are 92% similar to a (IRON-SULFUR PROTEIN DEHYDROGENASE SUCCINATE SUBUNIT) protein domain (PD000788) which is seen in Q51072_NEIGO.

Residues 8-45 are identical to a (FUMARATE REDUCTASE IRON-SULPHER PROTEIN) protein domain (PD190010) which is seen in Q51072_NEIGO.



Paralogs:  Local Blast Search


NG0920 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1KF6|1KF6-B E. COLI QUINOL-FUMARATE REDUCTASE WITH BOUND 163.0 3e-41
pdb|1E7P|1E7P-B QUINOL:FUMARATE REDUCTASE FROM WOLINELLA 113.0 3e-26
pdb|1KF6|1KF6-B E. COLI QUINOL-FUMARATE REDUCTASE WITH BOUND 356.0 2e-99
pdb|1E7P|1E7P-B QUIN

Gene Protein Sequence:
MRKGTLLMEKMSFEIYRYNPDVDAKPYMQRYELELEPTDVKLLDALVRLK
AQDDTLSFRRSCREGICGSDGMNINGKNGLACLTDLRSLKQPVKIRPLPG
LPVIRDLIVDMTQFFKQYHSVKPYVVNDNPIDADKERLQTQEERKELDGL
YECILCACCSTACPSFWWNPDKFVGPSGLLNAYRFIADSRDTITNERLDN
LNDPYRLFRCHTIMNCVDVCPKHLNPTRAIGKIKEIMLKRVV

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAAAAGGAACACTTCTCATGGAAAAAATGAGTTTTGAAATTTACCG
TTACAACCCGGACGTTGATGCCAAGCCTTATATGCAGCGTTACGAGTTGG
AATTGGAACCGACCGACGTGAAACTTTTGGACGCTTTGGTACGCCTGAAA
GCACAAGACGATACCTTGTCTTTCCGCCGCTCCTGCCGCGAAGGGATTTG
CGGATCGGACGGTATGAACATCAACGGCAAAAACGGCTTGGCGTGTCTGA
CCGATTTACGCAGCTTGAAACAGCCTGTCAAAATCCGCCCGCTGCCCGGT
CTGCCCGTCATCCGCGACCTGATTGTGGATATGACCCAGTTCTTCAAACA
ATACCATTCCGTCAAACCTTATGTTGTTAACGACAATCCGATTGATGCGG
ACAAAGAGCGTCTGCAAACTCAGGAAGAGCGCAAAGAGTTGGATGGTTTG
TACGAATGTATTTTGTGCGCCTGCTGTTCGACCGCCTGTCCGTCATTCTG
GTGGAATCCCGACAAATTCGTCGGTCCGTCCGGCTTGCTGAACGCCTACC
GCTTCATTGCGGACAGCCGAGATACCATCACTAATGAGCGTTTGGATAAT
TTGAACGATCCGTACCGTTTGTTCCGCTGCCACACCATTATGAACTGCGT
AGACGTATGTCCTAAACACTTGAATCCGACCCGAGCCATCGGTAAGATTA
AAGAGATTATGTTGAAACGGGTTGTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy