Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0732 IGR0734 IGR0739 IGR0733 IGR0731 IGR0738 IGR0730 IGR0740 IGR0741 IGR0735 IGR0736 IGR0737 IGR0742 IGR0729 IGR731.1 rubR, - NG0885 NG0879 NG0888 orfA, - NG0882 tmRNA,tag, - NG0880.1 NG0891 mip, - NG0887 orfB, - NG0881 acdS, - NG0886 dld,ldhd, - NG0890 NG0889 NG0892 NG0883 NG0884 NG0880 NG0878 NG0893 rubR, - NG0885 NG0879 NG0888 orfA, - NG0882 tmRNA,tag, - NG0880.1 NG0891 mip, - NG0887 orfB, - NG0881 acdS, - NG0886 dld,ldhd, - NG0890 NG0889 NG0892 NG0883 NG0884 NG0880 NG0878 NG0893 Type: inverse, Name:  - 184 Type: tandem, Name:  - 37 Type: direct, Name:  - 117 Type: inverse, Name:  - 169 rubR, - NG0885 NG0879 NG0888 orfA, - NG0882 tmRNA,tag, - NG0880.1 NG0891 mip, - NG0887 orfB, - NG0881 acdS, - NG0886 dld,ldhd, - NG0890 NG0889 NG0884 NG0880 NG0878 ffs, - NG0892.1 NG0893 NG0883 NG0892 ffs, - NG0892.1
* Calculated from Protein Sequence

Gene ID: NG0886

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
acdS  

Definition:
acyl-CoA dehydrogenase

Gene Start:
866936

Gene Stop:
865857

Gene Length:
1080

Molecular Weight*:
38259

pI*:
5.30

Net Charge*:
-7.63

EC:
1.3.99.3  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
beta-Alanine metabolism
Fatty acid metabolism
Propanoate metabolism
Valine, leucine and isoleucine degradation

Comment:
Oklahoma ID: NGO.886c

Blast Summary:  PSI-Blast Search
NG0886 is orthologous to AL162755, N. meningitidis Z2491 putative acyl-CoA dehydrogenase: residues 1-363 have 93% similarity to residues 1-360 in NG0886.

NG0886 also has moderate similarity to many acyl-CoA/isovaleryl-CoA dehydrogenase proteins in species outside of Neisseria. Residues 13-351 are 27% similar to 13700091, acyl-CoA dehydrogenase family protein, of Staphylococcus aureus.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1960
COG name: Acyl-CoA dehydrogenases
Functional Class:  I
The phylogenetic pattern of COG1960 is A-------EBR----------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG0886 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 110 (E-value = 1.1e-06) place NG0886 in the Acyl-CoA_dh_N family which is described as Acyl-CoA dehydrogenase, N-terminal domain (PF02771)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
202  
360
transmembrane  
224  
240

PDB Hit:
pdb|1IVH|1IVH-A STRUCTURE OF HUMAN ISOVALERYL-COA DEHYDROGENASE 50.8 4e-07
pdb|1BUC|1BUC-A BUTYRYL-COA DEHYDROGENASE (BCAD) (BACTERIAL 46.9 6e-06
pdb|1IVH|1IVH-A STRUCTURE OF HUMAN ISOVALERYL-COA DEHYDROGENASE 248.0 1e-66
pdb|1JQI|1JQI-A CRYS

Gene Protein Sequence:
MNAQTLLANVAELVKTKLKPLVDDIDRKGYYPEAFMRELGAIGAVGIEAE
GGNGLGLATRIAVLREIGKECGATSFSAWCQAACAWYLHQTPNQAVKDKY
LADILQGKVLAGTGMSNTVKHLAGIEKHNLQAECVEGGYTVNGALPWVSN
IGEDHIWANTAQIGGGYVMFITGGQREGVSLQNCPEFCALEGTHTFSLNF
KDVFIPDEDIIAAPEQFAGYIQSIKAGFILLQIGIGAGVIDGSLGIIRLV
NVVNAEVNSYLDDGYDSLKARLDGAWAETERLAGLAWDNTPDNLATLKLR
EAAAVLALAAAQSAALHSGAKGYLMRSPAQRRVGEAMFVAIVTPAIKHLC
KEIAAIEAAK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACGCCCAAACCCTGCTTGCCAACGTTGCCGAACTCGTCAAAACCAA
GCTCAAACCCCTCGTCGACGACATCGACCGCAAAGGATACTACCCCGAAG
CATTTATGCGCGAACTCGGCGCAATCGGCGCAGTCGGTATAGAAGCCGAA
GGCGGCAACGGCTTAGGCTTGGCAACACGAATCGCCGTCTTGCGCGAAAT
CGGCAAAGAATGCGGCGCGACCTCCTTCAGCGCGTGGTGTCAGGCGGCTT
GCGCGTGGTATCTGCACCAAACGCCCAACCAAGCCGTCAAAGACAAATAC
CTCGCCGACATCCTGCAAGGCAAAGTATTGGCGGGCACCGGAATGTCCAA
TACCGTCAAACACCTTGCCGGCATTGAAAAACACAACCTTCAAGCCGAGT
GCGTGGAGGGCGGTTATACAGTCAACGGTGCGCTGCCGTGGGTGTCCAAC
ATCGGCGAAGACCACATTTGGGCGAATACCGCCCAAATCGGCGGCGGCTA
CGTCATGTTCATCACAGGCGGGCAAAGGGAAGGCGTAAGCCTGCAAAACT
GCCCCGAATTTTGCGCCCTCGAAGGCACGCACACCTTCAGCCTGAATTTC
AAAGACGTATTTATTCCCGACGAAGACATCATCGCTGCGCCCGAACAGTT
TGCCGGCTACATCCAAAGCATCAAAGCAGGCTTCATCCTCCTGCAAATCG
GTATCGGCGCGGGCGTGATTGACGGCAGCCTCGGCATCATCCGCCTCGTC
AACGTCGTCAACGCCGAAGTCAACAGCTATCTCGACGACGGCTACGACAG
CCTCAAAGCAAGGCTGGACGGCGCGTGGGCAGAAACCGAACGGCTCGCCG
GATTGGCGTGGGACAACACGCCCGACAACCTCGCCACCCTCAAGCTGCGC
GAAGCCGCCGCCGTACTGGCCCTTGCCGCTGCGCAATCCGCCGCCCTGCA
TTCCGGCGCGAAAGGCTACCTGATGCGGAGTCCCGCCCAAAGGCGCGTCG
GCGAAGCGATGTTTGTCGCCATCGTAACCCCCGCAATCAAACACCTCTGC
AAAGAAATAGCAGCAATCGAAGCCGCAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy