Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0725 IGR0726 IGR0721 IGR0722 IGR0718 IGR0724 IGR0719.1 IGR0723 IGR0720 IGR0719 NG0867 NG0867.1 NG0871 dedA, - NG0869 opcA, - NG0868 dcrD, - NG0874 dcmD, - NG0873 purK, - NG0875 glyA, - NG0866 trpE, - NG0872 uup,abcZ, - NG0870 NG0867 NG0867.1 NG0871 dedA, - NG0869 opcA, - NG0868 dcrD, - NG0874 dcmD, - NG0873 purK, - NG0875 glyA, - NG0866 trpE, - NG0872 uup,abcZ, - NG0870 NG0867 NG0867.1 NG0871 dedA, - NG0869 opcA, - NG0868 dcrD, - NG0874 dcmD, - NG0873 purK, - NG0875 glyA, - NG0866 trpE, - NG0872 uup,abcZ, - NG0870
* Calculated from Protein Sequence

Gene ID: NG0870

DNA Molecule Name:
1  

Genbank ID:
5051428

Gene Name:
uup  abcZ  

Definition:
probable ABC-type transporter, ATP-binding protein (AbcZ)

Gene Start:
853094

Gene Stop:
855001

Gene Length:
1908

Molecular Weight*:
71722

pI*:
5.50

Net Charge*:
-11.25

EC:
 

Functional Class:
Transport and binding proteins; ABC Superfamily: ATP-binding protein  

Pathway: pathway table

Primary Evidence:
Zhu,P., Morelli,G. and Achtman,M.,
The opcA and (psi)opcB regions in Neisseria: genes, pseudogenes, deletions, insertion elements and DNA islands,
Mol. Microbiol. 33 (3), 635-650 (1999)
Medline: 99348393


Secondary Evidence:
Reddy,M. and Gowrishankar,J.
Identification and characterization of ssb and uup mutants with
increased frequency of precise excision of transposon Tn10
derivatives: nucleotide sequence of uup in Escherichia coli
J. Bacteriol. 179 (9), 2892-2899 (1997)
Medline: 97284491

Koh,Y.S. and Roe,J.H.
Isolation of a novel paraquat-inducible (pqi) gene regulated by the soxRS locus in Escherichia coli
J. Bacteriol. 177 (10), 2673-2678 (1995)
Medline: 95270582



Comment:
For other 'abc' genes see NG2137 ( abc ).

Oklahoma ID: NGO.870

See ABC Transporters Analysis Section




Blast Summary:  PSI-Blast Search
NG0870 is 100% identical to a previously sequenced Neisseria gonorrhoeae protein in GenBank, 5051428|.

Residues 1-636 are 96% similar to a probable ABC transporter ATP-binding protein in Neisseria meningitidis group A strain Z2491 (11346265|).

Numerous hits in gapped BLAST to probable ABC transporter ATP-binding protein / ABC-type transport protein uup-1 sequences,e.g.residues 1-632 are 48% similar to ABC transporter,ATP-binding protein in Haemophilus influenzae strain Rd KW20 (1574757|).Residues 1-633 are 46% similar to ABC-type transport protein uup in Escherichia coli (2506112|).Residues 1-628 are 50% similar to a probable ATP-binding component of ABC transporter in Pseudomonas aeruginosa strain PAO1 (11351026|).




COGS Summary:  COGS Search
BeTs to 10 clades of COG0488
COG name: ATPase components of ABC transporters with duplicated ATPase domains
Functional Class:  R
The phylogenetic pattern of COG0488 is ----Y--CEBRHuj--olinx
Number of proteins in this genome belonging to this COG is 4

Blocks Summary:  Blocks Search
***** IPB001140 (ABC transporter transmembrane region) with a combined E-value of 2.4e-22.
    IPB001140A    334-380
    IPB001140B    438-476


ProDom Summary:  Protein Domain Search
Residues 338-376 are 69% similar to a (ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC) protein domain (PD000005) which is seen in UUP1_HAEIN.

Residues 485-533 are 53% similar to a (PROTEIN ATP-BINDING TRANSPORTER ABC TRANSPORT REPEAT) protein domain (PD000796) which is seen in O50544_SYNP7.

Residues 441-483 are 69% similar to a (ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC) protein domain (PD000006) which is seen in UUP1_HAEIN.

Residues 379-440 are 48% similar to a (ABC TRANSPORTER ATP-BINDING PROTEIN) protein domain (PD019239) which is seen in UUP1_HAEIN.

Residues 419-518 are 31% similar to a (ATP-BINDING PROTEIN NUCLEOTIDE BINDING) protein domain (PD068705) which is seen in EXPZ_BACSU.



Paralogs:  Local Blast Search


NG0870 is paralogously related to NG1573 (ABC transporter, ATP-binding protein, NBD-NBD fusion protein) (2e-98), NG0764 (ABC-transporter, ATP-binding protein, NBD-NBD fusion protein) (5e-74), NG0781 (ABC transporter, ATP-binding protein, NBD-NBD fusion protein) (3e-71), NG2137 (ABC transporter, ATP-binding protein) (4e-18), NG2013 (ABC transporter, ATP-binding protein, amino acid) (1e-17), NG0374 (amino acid ABC transporter, ATP-binding protein) (2e-17), NG0215 (iron-uptake permease ATP-binding protein) (3e-14), NG0269 (amino acid ABC transporter, ATP-binding protein) (4e-14), NG0445 (sulfate ABC transporter, ATP-binding protein) (7e-14), NG0770 (lipoprotein releasing factor (probable ABC-transporter, ATP-binding protein) (LolD)) (4e-13), NG1732 (probable ABC transporter, MSD-NBD fusion protein) (6e-13), NG2116 (ABC transporter, ATP-binding protein) (1e-12), NG0170 (ABC transporter, ATP-binding protein) (2e-12), NG1605 (probable ABC transporter ATP-binding protein) (2e-12), NG1922 (filamentation temperature sensitive cell division) (3e-12), NG0192 (spermidine/putrescine ABC transporter, ATP-binding protein) (3e-12), NG1439 (ABC transporter, ATP-binding) (5e-12), NG1399 (ABC transporter, ATP-binding protein (NosF)) (7e-12), NG2088 (ABC transporter, ATP-binding protein, iron related) (3e-11), NG2165 (ABC transporter, ATP-binding) (1e-10), NG2039 (spermidine/putrescine ABC transporter, ATP-binding protein) (1e-10), NG1434 (ABC transporter, ATP-binding protein) (5e-07) and NG0126 (conserved hypothetical protein) (3e-05).


Pfam Summary:  Pfam Search
Residues 29 to 229 (E-value = 2.5e-53) place NG0870 in the ABC_tran family which is described as ABC transporter (PF00005)
Residues 345 to 513 (E-value = 6.2e-35) place NG0870 in the ABC_tran family which is described as ABC transporter (PF00005)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
87  
130
non-globular  
242  
328
coil-coil  
577  
636

PDB Hit:
pdb|1G29|1G29-1 MALK 81.1 5e-16
pdb|1B0U|1B0U-A ATP-BINDING SUBUNIT OF THE HISTIDINE PERMEASE 74.1 7e-14
pdb|1JJ7|1JJ7-A CRYSTAL STRUCTURE OF THE C-TERMINAL ATPASE 66.7 1e-11
pdb|1JSQ|1JSQ-A STRU

Gene Protein Sequence:
MNILSVENASFAVGHVALLDKTSFQLDSGEKVGLIGRNGAGKSSFLKILT
GVQKLDDGQIIVQNNLKIVYVPQESFFDKDATVFDTVAEGLGEIRDLLRR
YHHVSHELENGSSELLLKELNELQLEIEAKDGWKLDAAVKQTLGELGLPE
NKKIGNLSGGQKKRVALAQAWVQKPDVLLLDEPTNHLDIDAIIWLENLLK
AFEGSLVVITHDRRFLDNIATRIVELDRGILRSYPGSFSKYSEKKAQELA
VEAEHNRLFDKFHAQEEAWIRKGIEARRTRNEGRVRRLEELRRQRAERRN
VQGQVNFKLDSGKKSGKIIAELEHASFAYDDKVIMDKFSAILQRGDKIGL
IGPNGIGKTTFLKLILGELQPTYGRIRIGSKQEVAYFDQFRSALNENDTV
FYTLGQGNDYVEVGGKKKHVMSYLEDFLFPPARAQSPVSSLSGGERNRLL
LAKLFTRPANILVLDEPTNDLDIDTQELLEDLLRDYQGTVFLVSHDRMFL
DNVITQSIVFEGQGRLKEYIGGYQDYIDAKSREDKIQTASAPKASDVEPA
KEKPKANRTVKLSYKEQRELDALPDEIAALETEQAEINAQLSDPGIFKDY
EKAGALQNRAEEIEMLLLEKLERWELLETKQNGNAV

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATATATTATCCGTAGAAAACGCTTCCTTTGCCGTCGGACATGTCGC
CCTGCTCGACAAAACGTCCTTCCAACTCGACAGCGGCGAAAAAGTCGGCT
TGATCGGACGCAACGGCGCAGGCAAGTCTTCGTTTTTAAAAATCCTCACC
GGCGTGCAAAAACTCGACGACGGGCAGATTATTGTTCAAAACAATCTCAA
AATCGTTTATGTGCCGCAGGAGTCCTTTTTTGATAAGGACGCAACCGTAT
TTGATACTGTTGCCGAAGGTTTGGGCGAAATTCGCGATTTATTGCGCCGT
TATCATCATGTCAGCCATGAGTTGGAAAATGGTTCGAGTGAGCTCTTATT
GAAAGAGCTTAACGAATTGCAACTTGAAATCGAAGCGAAGGACGGTTGGA
AACTGGATGCGGCAGTCAAGCAGACTTTGGGGGAACTCGGTTTGCCGGAA
AACAAAAAAATCGGCAACCTTTCCGGCGGTCAGAAAAAACGCGTCGCCTT
AGCGCAGGCTTGGGTACAGAAGCCCGATGTATTGTTACTGGACGAACCGA
CCAACCATTTGGATATCGACGCGATTATTTGGTTGGAAAACCTGCTCAAA
GCGTTTGAAGGCAGCTTGGTCGTGATTACCCACGACCGCCGTTTTTTGGA
CAATATCGCCACGCGCATTGTCGAACTCGATCGCGGTATTTTGCGCTCCT
ATCCCGGCTCGTTCTCCAAATACAGCGAGAAAAAAGCGCAAGAGTTGGCG
GTTGAAGCCGAACACAACCGCCTCTTCGACAAATTCCACGCGCAGGAAGA
GGCGTGGATACGCAAAGGCATCGAAGCGCGCCGTACCCGCAACGAAGGCC
GCGTGCGCCGTTTGGAAGAACTGCGCCGCCAGCGTGCCGAACGCCGCAAT
GTACAAGGACAGGTCAACTTCAAACTCGACAGCGGCAAGAAAAGCGGCAA
AATCATCGCCGAACTGGAACACGCTTCGTTTGCCTATGACGACAAAGTTA
TCATGGATAAATTTTCCGCCATCTTGCAGCGCGGCGACAAAATCGGCTTA
ATCGGCCCAAACGGTATCGGCAAAACCACCTTCCTTAAGCTGATTTTGGG
CGAATTGCAGCCGACCTACGGCAGAATCCGTATCGGCAGCAAGCAGGAAG
TCGCCTATTTCGACCAGTTCCGCAGCGCCTTGAATGAAAACGATACTGTG
TTTTACACGCTCGGACAGGGCAACGATTACGTCGAAGTCGGCGGCAAGAA
AAAGCATGTGATGAGCTATTTGGAAGATTTCCTGTTCCCCCCTGCCCGCG
CGCAAAGTCCTGTTTCTTCACTCTCCGGCGGCGAACGCAACCGCCTTTTG
CTGGCAAAACTCTTTACTCGTCCCGCCAATATTTTGGTTTTGGACGAACC
GACCAACGACTTGGACATCGACACCCAAGAATTGCTTGAAGATCTGTTGC
GCGATTACCAAGGCACGGTCTTCCTCGTCTCGCACGACCGTATGTTCCTC
GACAATGTAATTACCCAAAGCATTGTTTTCGAAGGACAAGGCCGTCTGAA
AGAATACATCGGCGGCTATCAGGACTATATCGACGCAAAATCGCGGGAAG
ATAAAATTCAGACGGCATCCGCACCCAAAGCATCCGATGTCGAACCCGCC
AAAGAAAAACCCAAAGCCAACCGTACGGTCAAACTTTCCTACAAAGAACA
GCGCGAACTCGACGCCCTGCCCGACGAAATCGCCGCCTTGGAAACCGAAC
AGGCAGAAATCAACGCGCAGCTTTCCGATCCCGGAATTTTCAAAGATTAC
GAAAAAGCAGGAGCATTGCAAAACCGCGCCGAAGAAATCGAAATGCTGCT
TTTGGAAAAGCTGGAACGCTGGGAGCTGCTGGAAACCAAACAGAACGGCA
ATGCCGTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy