Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0721 IGR0722 IGR0717 IGR0718 IGR0719.1 IGR0723 IGR0720 IGR0716.2 IGR0716 IGR0719 IGR0716.1 NG0867 NG0865 NG0867.1 NG0871 ggt, - NG0864.1 ggt, - NG0864 dedA, - NG0869 opcA, - NG0868 glyA, - NG0866 trpE, - NG0872 uup,abcZ, - NG0870 NG0867 NG0865 NG0867.1 NG0871 ggt, - NG0864.1 ggt, - NG0864 dedA, - NG0869 opcA, - NG0868 glyA, - NG0866 trpE, - NG0872 uup,abcZ, - NG0870 NG0867 NG0865 NG0867.1 NG0871 ggt, - NG0864.1 ggt, - NG0864 dedA, - NG0869 opcA, - NG0868 glyA, - NG0866 trpE, - NG0872 uup,abcZ, - NG0870
* Calculated from Protein Sequence

Gene ID: NG0867.1

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
851135

Gene Stop:
851401

Gene Length:
267

Molecular Weight*:
10355

pI*:
4.90

Net Charge*:
-3.67

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-89 are identical to AJ242839, a hypothetical protein from Neisseria gonorrhoeae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


NG0867.1 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MRDVRDIERLISRNVPLRRIGDAIQNMCMETNVSIRMYRQECRSESSDFY
DEMLEHHENFIGSSKSFASSLLPLSVTNFTTDMACTPEF

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAGATGTTAGGGACATAGAAAGGCTAATAAGCCGAAACGTCCCTTT
ACGTCGTATCGGAGACGCCATTCAAAACATGTGCATGGAAACCAATGTGT
CCATTAGGATGTATCGCCAGGAGTGCCGTTCAGAATCGTCAGATTTTTAT
GACGAAATGCTTGAGCATCACGAGAATTTCATAGGATCCTCCAAATCATT
CGCATCATCACTTCTTCCCCTTAGCGTTACAAACTTTACAACAGACATGG
CGTGTACTCCCGAATTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy