Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0721 IGR0722 IGR0717 IGR0718 IGR0719.1 IGR0723 IGR0720 IGR0715 IGR0716.2 IGR0716 IGR0719 IGR0716.1 NG0863 NG0867 NG0865 NG0867.1 NG0871 ggt, - NG0864.1 ggt, - NG0864 dedA, - NG0869 opcA, - NG0868 f16p,fbp, - NG0862 glyA, - NG0866 uup,abcZ, - NG0870 NG0863 NG0867 NG0865 NG0867.1 NG0871 ggt, - NG0864.1 ggt, - NG0864 dedA, - NG0869 opcA, - NG0868 f16p,fbp, - NG0862 glyA, - NG0866 uup,abcZ, - NG0870 NG0863 NG0867 NG0865 NG0867.1 NG0871 ggt, - NG0864.1 ggt, - NG0864 dedA, - NG0869 opcA, - NG0868 f16p,fbp, - NG0862 glyA, - NG0866 uup,abcZ, - NG0870
* Calculated from Protein Sequence

Gene ID: NG0867

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (possible transcriptional regulator)

Gene Start:
850549

Gene Stop:
850163

Gene Length:
387

Molecular Weight*:
15040

pI*:
5.20

Net Charge*:
-4.27

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.867c

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to hypothetical proteins. NG0867 also has weak similarity (P-value = 5e-05) to U32824, H. influenzae predicted coding region HI1458. Also two very weak hits to transcriptional regulators (10172958, 12724246).

NG0867 is orthologous to AE002371, N. meningitidis MC58 conserved hypothetical protein : residues 1-121 have 42% similarity to residues 1-121 in NG0867.


COGS Summary:  COGS Search
BeTs to 3 clades of COG1396
COG name: Predicted transcriptional regulators
Functional Class:  K
The phylogenetic pattern of COG1396 is --T--qV-EBR---------x
Number of proteins in this genome belonging to this COG is 5

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 34-115 are 35% similar to a (SIMILAR TO H.INFLUENZAE RD) protein domain (PD067689) which is seen in Q51849_PASHA.

Residues 49-115 are 42% similar to a (HYPOTHETICAL PROTEIN HI1458) protein domain (PD059535) which is seen in YE58_HAEIN.



Paralogs:  Local Blast Search


NG0867 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 61 (E-value = 2.9e-14) place NG0867 in the HTH_3 family which is described as Helix-turn-helix (PF01381)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
22  
64
coil-coil  
90  
129

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MEVHDKIRTLREVNQWTQEEMAEKLEMSVNGYSKIERGKSGINLDKLRQI
AQIFNIDVVELLAEQNRSFFFSIGDNTNNHHNIIGSDEMLVFENEKLRSL
LDAKDELIRQKDSEIAVLKKLVILLEEKK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAGTGCATGACAAGATTCGGACGTTAAGGGAAGTCAATCAGTGGAC
GCAGGAAGAGATGGCGGAAAAATTGGAAATGTCGGTTAACGGGTATTCGA
AAATAGAACGCGGGAAAAGCGGCATCAATCTCGACAAGCTGCGCCAGATT
GCCCAGATTTTCAATATCGATGTGGTTGAGCTGCTGGCGGAGCAGAACCG
ATCGTTTTTCTTCTCTATCGGCGACAATACCAATAACCATCATAATATTA
TCGGCTCTGATGAAATGCTGGTGTTTGAAAATGAAAAATTGAGGTCGCTG
CTGGATGCAAAGGATGAATTGATCAGGCAGAAAGATAGTGAAATCGCAGT
ATTGAAAAAGTTGGTCATTTTGCTGGAAGAGAAAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy