Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0721 IGR0717 IGR0718 IGR0719.1 IGR0720 IGR0715 IGR0716.2 IGR0714 IGR0716 IGR0719 IGR0716.1 NG0863 NG0867 NG0865 NG0867.1 ggt, - NG0864.1 ggt, - NG0864 dedA, - NG0869 opcA, - NG0868 f16p,fbp, - NG0862 glyA, - NG0866 uup,abcZ, - NG0870 NG0863 NG0867 NG0865 NG0867.1 ggt, - NG0864.1 ggt, - NG0864 dedA, - NG0869 opcA, - NG0868 f16p,fbp, - NG0862 glyA, - NG0866 uup,abcZ, - NG0870 NG0863 NG0867 NG0865 NG0867.1 ggt, - NG0864.1 ggt, - NG0864 dedA, - NG0869 opcA, - NG0868 f16p,fbp, - NG0862 glyA, - NG0866 uup,abcZ, - NG0870
* Calculated from Protein Sequence

Gene ID: NG0866

DNA Molecule Name:
1  

Genbank ID:
5051423

Gene Name:
glyA  

Definition:
serine hydroxymethyltransferase

Gene Start:
848837

Gene Stop:
850084

Gene Length:
1248

Molecular Weight*:
44979

pI*:
6.60

Net Charge*:
-2.33

EC:
2.1.2.1  

Functional Class:
Amino acid biosynthesis; Serine family  

Pathway: pathway table
Cyanoamino acid metabolism
Glycine, serine and threonine metabolism
Lysine degradation
Methane metabolism
One carbon pool by folate

Primary Evidence:
Zhu,P., Morelli,G. and Achtman,M.,
The opcA and (psi)opcB regions in Neisseria: genes, pseudogenes, deletions, insertion elements and DNA islands,
Mol. Microbiol. 33 (3), 635-650 (1999) Medline: 99348393.

Zhu,P., van der Ende,A., Falush,D., Brieske,N., Morelli,G.,
Bodo,L., Popovic,T., Schuurman,I.G.A., Adegbola,R.A., Zurth,K.,
Gagneux,S., Platonov,A.E., Riou,J.Y., Caugant,D.A., Nicolas,P. and
Achtman,M.
Fit genotypes and escape variants of subgroup III Neisseria
meningitidis during three pandemics of epidemic meningitis
Proc. Natl. Acad. Sci. U.S.A. 98 (9), 5234-5239 (2001)
PUBMED: 11287631


Secondary Evidence:
Plamann,M.D. and Stauffer,G.V. Characterization of the Escherichia coli gene for serine hydroxymethyltransferase. Gene 22 (1): 9-18 (1983) [Medline: 83235562].

Comment:
For other 'gly' genes see NG2153 (glyQ) and NG2154 (glyS).

From GenBANK (gi:6919899): This protein performs the interconversion of serine and glycine, by the reaction: 5,10-methylenetetrahydrofolate + glycine + H2O = tetrahydrofolate + l-serine, with a cofactor, pyridoxal phosphate. It is a key enzyme in the biosynthesis of purines, lipids, hormones and other components. This cytoplasmic homotetramer belongs to the ShmT family.

Oklahoma ID: NGO.866

Blast Summary:  PSI-Blast Search
NG0866 is 100% identical to a previously sequenced Neisseria gonorrhoeae protein in GenBank, 5051423, submitted as CAB45001, serine hydroxymethyltransferase by Zhu,P., Morelli,G. and Achtman,M.

Numerous significant hits in gapped BLAST to serine hydroxymethyltransferases; e.g. residues 1-415 are 69% similar to 11352560 of Pseudomonas aeruginosa.

Residues 1-415 are 97% similar to NMB1055 and NMA1254, both serine hydroxymethyltransferases of N.meningitidis (9910686, 8928572).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0112
COG name: Glycine hydroxymethyltransferase
Functional Class:  E
The phylogenetic pattern of COG0112 is amtkYqvcebRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001085 (Serine hydroxymethyltransferase (SHMT)) with a combined E-value of 3.8e-169.
    IPB001085A    37-86
    IPB001085B    101-130
    IPB001085C    182-232
    IPB001085D    249-285
    IPB001085E    328-350
    IPB001085F    357-381


ProDom Summary:  Protein Domain Search
Residues 8-384 are 68% similar to a (HYDROXYMETHYLTRANSFERASE SERINE TRANSFERASE METHYLASE) protein domain (PD001547) which is seen in O85718_ACIRA.



Paralogs:  Local Blast Search


NG0866 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 8 to 384 (E-value = 1.4e-248) place NG0866 in the SHMT family which is described as Serine hydroxymethyltransferase (PF00464)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1DFO|1DFO-A CRYSTAL STRUCTURE AT 2.4 ANGSTROM RESOLUTION OF 558.0 0e+00
pdb|1EQB|1EQB-A X-RAY CRYSTAL STRUCTURE AT 2.7 ANGSTROMS 556.0 0e+00
pdb|1KKJ|1KKJ-A CRYSTAL STRUCTURE OF SERINE 499.0 0e+00
pdb|1CJ0|1CJ0-A CRYS

Gene Protein Sequence:
MFSKSVTLAQYDPDLAAAIAQEDRRQQDHVELIASENYVSCAVMEAQGSQ
LTNKYAEGYPAKRYYGGCEYVDIVEQLAIDRVKELFGAAYANVQPHSGSQ
ANQAVYASVLKPGDTILGMSLAHGGHLTHGASVNISGKLYNAVTYGLDEN
EVLDYAEVERLALEHKPKMIVAGASAYALQIDWAKFREIADKVGAYLFVD
MAHYAGLVAGGEYPNPVPFCDFVTTTTHKTLRGPRGGVILCRDNTHEKAL
NSSIFPSLQGGPLMHVIAAKAVAFKEALQPEFKQYAKQVKINAAVMAEEL
VKRGLRIVSGRTESHVFLVDLQPMKITGKAAEAALGKAHITVNKNAIPND
PEKPFVTSGIRIGSAAMTTRGFNETDARVLSNLVADVLANPEDEANLAKV
RGQVTALCDKYPVYGT

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTTCAAAAAGCGTTACCCTCGCACAATATGACCCCGATTTGGCAGC
AGCCATTGCCCAAGAAGACCGACGCCAGCAAGACCACGTCGAGCTGATTG
CCTCTGAAAACTACGTCAGCTGCGCCGTGATGGAGGCACAAGGTTCGCAA
TTGACCAACAAATACGCCGAAGGCTATCCCGCAAAACGCTACTACGGCGG
CTGCGAATACGTCGATATTGTCGAACAATTGGCAATCGACCGCGTAAAAG
AACTGTTTGGCGCAGCCTATGCCAACGTTCAACCGCACTCCGGTTCCCAA
GCCAACCAAGCCGTATATGCTTCCGTTTTAAAACCGGGCGACACCATTTT
GGGTATGTCTCTGGCGCACGGCGGACACCTGACCCACGGCGCGAGCGTTA
ATATTTCCGGCAAACTCTACAATGCCGTTACTTATGGCTTGGATGAAAAC
GAAGTCCTCGATTATGCCGAAGTCGAACGCCTCGCGCTCGAACACAAACC
CAAAATGATTGTGGCGGGCGCGTCTGCCTACGCGTTGCAAATCGACTGGG
CAAAATTCCGCGAAATCGCCGATAAAGTCGGCGCATACCTCTTTGTCGAC
ATGGCGCACTATGCCGGACTGGTTGCCGGCGGCGAATATCCTAACCCCGT
GCCATTCTGCGACTTCGTAACCACTACCACCCACAAAACCCTACGCGGCC
CTCGCGGCGGTGTGATTTTGTGCCGTGACAATACCCACGAAAAAGCGCTG
AACTCTTCCATCTTCCCAAGCCTGCAAGGCGGTCCGTTGATGCACGTTAT
CGCCGCCAAAGCCGTAGCGTTTAAAGAAGCGTTGCAACCCGAGTTCAAAC
AATACGCAAAACAAGTGAAAATCAATGCTGCCGTCATGGCGGAAGAGTTG
GTTAAACGCGGTTTGCGCATCGTTTCCGGCCGCACCGAAAGCCACGTTTT
CCTCGTCGACCTGCAACCGATGAAAATCACCGGCAAAGCCGCCGAAGCCG
CTTTGGGCAAAGCGCACATCACCGTCAACAAAAACGCCATCCCGAACGAT
CCGGAAAAACCGTTCGTTACCTCCGGCATCCGCATCGGTTCCGCCGCCAT
GACCACTCGCGGCTTTAACGAAACCGACGCTCGCGTATTGTCGAACTTGG
TTGCCGATGTATTGGCTAATCCCGAAGACGAAGCCAACCTCGCCAAAGTC
CGCGGACAAGTGACTGCCTTGTGCGACAAATACCCCGTTTACGGAACC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy