Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0712 IGR0721 IGR0713 IGR0717 IGR0718 IGR0719.1 IGR0720 IGR0715 IGR0716.2 IGR0714 IGR0716 IGR0719 IGR0716.1 NG0863 NG0861 NG0867 NG0865 NG0867.1 NG0860 ggt, - NG0864.1 ggt, - NG0864 dedA, - NG0869 opcA, - NG0868 NG0859 f16p,fbp, - NG0862 glyA, - NG0866 uup,abcZ, - NG0870 NG0863 NG0861 NG0867 NG0865 NG0867.1 NG0860 ggt, - NG0864.1 ggt, - NG0864 dedA, - NG0869 opcA, - NG0868 NG0859 f16p,fbp, - NG0862 glyA, - NG0866 uup,abcZ, - NG0870 NG0863 NG0861 NG0867 NG0865 NG0867.1 ggt, - NG0864.1 ggt, - NG0864 dedA, - NG0869 opcA, - NG0868 NG0859 f16p,fbp, - NG0862 glyA, - NG0866 uup,abcZ, - NG0870 NG0860
* Calculated from Protein Sequence

Gene ID: NG0865

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Neisseria-specific protein, uncharacterized

Gene Start:
848528

Gene Stop:
848767

Gene Length:
240

Molecular Weight*:
8894

pI*:
4.30

Net Charge*:
-4.01

EC:
 

Functional Class:
Neisseria-specific protein  
Unknown  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.865

Blast Summary:  PSI-Blast Search
One significant hit in gapped BLAST. NG0865 is orthologous to AE002456, N. meningitidis MC58 hypothetical protein: residues 11-80 have 92% similarity to residues 1-70 in NG0865.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG0865 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MAGQEELSWQVVYQRVMADKDVVGAGYLIDFAQTAENLPFDVLPLISLVL
NKGDETLKTGMLNKLPDNAKENLRIMGYLP

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGGGGCAGGAAGAATTGTCTTGGCAAGTGGTGTATCAGCGGGTTAT
GGCTGATAAAGATGTGGTTGGTGCTGGTTATTTGATTGATTTTGCACAAA
CTGCCGAAAATTTACCATTTGATGTATTGCCTTTGATTAGCCTTGTGCTA
AATAAAGGTGATGAGACGCTAAAAACCGGCATGTTAAATAAATTACCTGA
TAATGCCAAAGAAAATTTACGCATTATGGGCTATCTGCCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy