Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0712 IGR0721 IGR0713 IGR0717 IGR0718 IGR0719.1 IGR0720 IGR0715 IGR0716.2 IGR0714 IGR0716 IGR0719 IGR0716.1 NG0863 NG0861 NG0867 NG0865 NG0867.1 NG0860 ggt, - NG0864.1 ggt, - NG0864 dedA, - NG0869 opcA, - NG0868 NG0859 f16p,fbp, - NG0862 glyA, - NG0866 uup,abcZ, - NG0870 NG0863 NG0861 NG0867 NG0865 NG0867.1 NG0860 ggt, - NG0864.1 ggt, - NG0864 dedA, - NG0869 opcA, - NG0868 NG0859 f16p,fbp, - NG0862 glyA, - NG0866 uup,abcZ, - NG0870 NG0863 NG0861 NG0867 NG0865 NG0867.1 ggt, - NG0864.1 ggt, - NG0864 opcA, - NG0868 NG0859 f16p,fbp, - NG0862 glyA, - NG0866 uup,abcZ, - NG0870 NG0860 dedA, - NG0869
* Calculated from Protein Sequence

Gene ID: NG0864.1

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ggt  

Definition:
gamma-glutamyltranspeptidase

Gene Start:
847858

Gene Stop:
848352

Gene Length:
495

Molecular Weight*:
17948

pI*:
7.50

Net Charge*:
0.23

EC:
2.3.2.2  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Thioredoxin, glutaredoxin, and glutathione  

Pathway: pathway table
Cyanoamino acid metabolism
Glutathione metabolism
Prostaglandin and leukotriene metabolism
Selenoamino acid metabolism
Taurine and hypotaurine metabolism

Primary Evidence:
Chu L, Xu X, Dong Z, Cappelli D, Ebersole JL.
Role for recombinant gamma-glutamyltransferase from Treponema denticola in glutathione metabolism.
Infect Immun. 2003 Jan;71(1):335-42.
PMID: 12496183

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-165 are 44% similar to residues 461-641 in Z81368, a ggtB from Mycobacterium tuberculosis.

Residues 2-164 are 40% similar to residues 419-581 in U49358, a gamma-glutamyltranspeptidase from Bacillus subtilis.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0405
COG name: Gamma-glutamyltranspeptidase
Functional Class:  E
The phylogenetic pattern of COG0405 is ----y--ceBR-uj-------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000101 (Gamma-glutamyltranspeptidase) with a combined E-value of 6.4e-29.
    IPB000101B    32-76
    IPB000101C    107-161
    IPB000101B    31-75
    IPB000101C    82-136


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


NG0864.1 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MTTSIENAFGSTLMANGYLLNNELTDFSFEPIKQGKQVANRVEPGKRPRS
SMAPTIVFKAGKPYMAIGSPGGSRIIGYVAKTIVAHSDWNMDIQDAISAP
NLLNRFGSYELETGTTAVQWQQTLNDLGYKTDVRELNSGVQAIIIEPSRL
VGGVDPRREGRVTGD

Gene Nucleotide Sequence:  Sequence Viewer
ATGACGACTTCCATTGAAAATGCGTTTGGCTCAACTTTGATGGCAAATGG
CTACCTGCTGAATAATGAGCTGACAGACTTTAGTTTTGAGCCAATAAAGC
AGGGCAAACAGGTCGCCAATCGTGTCGAGCCTGGCAAGAGACCACGCTCC
TCAATGGCACCAACCATCGTATTTAAAGCAGGCAAGCCTTATATGGCAAT
CGGCTCTCCAGGTGGTAGCCGTATCATTGGCTATGTCGCTAAGACGATTG
TGGCACATAGTGACTGGAATATGGATATCCAAGATGCCATCAGTGCACCC
AATTTATTAAATCGCTTTGGTAGCTATGAACTAGAAACGGGTACAACCGC
CGTCCAGTGGCAACAAACATTAAATGATTTGGGCTATAAGACTGATGTGC
GTGAGCTAAATTCAGGTGTTCAAGCCATTATTATCGAGCCAAGCAGGCTG
GTTGGTGGTGTCGATCCACGCCGAGAAGGTCGAGTGACGGGTGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy