Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0712 IGR0707 IGR0713 IGR0710 IGR0717 IGR0718 IGR0711 IGR0715 IGR0716.2 IGR0709 IGR0709.1 IGR0714 IGR0708 IGR0716 IGR0716.1 NG0854 NG0863 NG0861 folB, - NG0857 NG0855 NG0865 crcB, - NG0853 NG0860 ggt, - NG0864.1 ggt, - NG0864 NG0858 NG0852 NG0859 f16p,fbp, - NG0862 glyA, - NG0866 NG0854 NG0863 NG0861 folB, - NG0857 NG0855 NG0865 crcB, - NG0853 NG0860 ggt, - NG0864.1 ggt, - NG0864 NG0858 NG0852 NG0859 f16p,fbp, - NG0862 glyA, - NG0866 NG0863 NG0861 folB, - NG0857 NG0855 NG0854 NG0865 NG0860 ggt, - NG0864.1 ggt, - NG0864 NG0858 NG0852 NG0859 f16p,fbp, - NG0862 glyA, - NG0866 crcB, - NG0853
* Calculated from Protein Sequence

Gene ID: NG0862

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
f16p  fbp  

Definition:
fructose-1,6-bisphosphatase

Gene Start:
844638

Gene Stop:
845609

Gene Length:
972

Molecular Weight*:
35461

pI*:
5.20

Net Charge*:
-7.58

EC:
3.1.3.11  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Carbon fixation
Fructose and mannose metabolism
Glycolysis / Gluconeogenesis
Pentose phosphate cycle

Secondary Evidence:
Yoo,J.G. and Bowien,B.
Analysis of the cbbF genes from Alcaligenes eutrophus that encode fructose-1,6-/sedoheptulose- 1,7-bisphosphatase.
Curr. Microbiol. 31 (1): 55-61 (1995)
[Medline: 95284722]

Nunes FB, Graziottin CM, Alves Filho JC, Lunardelli A, Pires MG, Wachter PH, De Oliveira JR.
An assessment of fructose-1,6-bisphosphate as an antimicrobial and anti-inflammatory agent in sepsis.
Pharmacol Res. 2003 Jan;47(1):35-41.
PMID: 12526859.

Comment:
From GenBANK (gi:585119): F1,6BP catalyzes the reaction: d-fructose 1,6-bisphosphate + H2O = d-fructose 6-phosphate + orthophosphate. It is a key enzyme of the reductive pentose phosphate pathway or calvin cycle of photosynthetic carbon dioxide assimilation. F1,6BP belongs the FBPase family.

Oklahoma ID: NGO.862

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to fructose-1,6-bisphosphatases; e.g. residues 3-324 are 54% similar to 11348563 of Pseudomonas aeruginosa.

NG0862 is orthologous to AE002456, N. meningitidis MC58 fructose-1,6-bisphosphatase: residues 1-324 have 95% similarity to residues 1-324 in NG0862.

COGS Summary:  COGS Search
BeTs to 4 clades of COG0158
COG name: Fructose-1,6-biphosphatase
Functional Class:  G
The phylogenetic pattern of COG0158 is ----y--ce--huj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000146 (Inositol phosphatase/fructose-1,6-bisphosphatase) with a combined E-value of 2.5e-82.
    IPB000146A    49-91
    IPB000146B    100-127
    IPB000146C    142-176
    IPB000146D    264-284


ProDom Summary:  Protein Domain Search
Residues 58-315 are 56% similar to a (HYDROLASE CARBOHYDRATE METABOLISM FRUCTOSE-1) protein domain (PD001491) which is seen in F16R_ALCEU.



Paralogs:  Local Blast Search


NG0862 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 324 (E-value = 1.7e-150) place NG0862 in the FBPase family which is described as Fructose-1-6-bisphosphatase (PF00316)

Structural Feature(s):
Feature Type  Start  Stop
may be a lipoprotein  
  

PDB Hit:
pdb|1D9Q|1D9Q-A OXIDIZED PEA FRUCTOSE-1,6-BISPHOSPHATASE FORM 1 239.0 6e-64
pdb|1DBZ|1DBZ-A C153S MUTANT OF PEA FRUCTOSE-1,6-BISPHOSPHATASE 239.0 6e-64
pdb|1SPI|1SPI-A FRUCTOSE-1,6-BISPHOSPHATASE 226.0 4e-60
pdb|1FSA|1FSA-A THE

Gene Protein Sequence:
MDTLTRFLPEHLQQNQLPEALGGVLLSVVSACTEINAKVRLGALAGVLGM
AGTGNIQGEDQKKLDVIANNIMIDTLKANPAVAGLASEEEDTFVSAGENG
RYLVLFDPLDGSSNIDVNISVGTIFSILAKPEGALATESFLQTGRQQLAA
GYVLYGPQTQLVFTFGHGVYVFTLNAENEFVLTKENPKVPESTKEFAINM
SNRRHWLPPVQQYVDELLAGETGTRGKNYNMRWVASMVAEIHRILMRGGV
FMYLQDKRDPSKPGKLRLMYEANPMALILEQAGASASNAYQAMLDIQPES
LHQRVAVIMGSSEEVDYLNRLHSK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGACACACTGACCCGATTCCTCCCCGAACACCTGCAACAAAACCAACT
GCCCGAAGCACTCGGCGGCGTTTTGCTGTCCGTCGTTTCCGCCTGTACCG
AAATCAACGCCAAAGTCCGCCTCGGCGCACTTGCCGGCGTATTGGGTATG
GCGGGCACGGGCAATATTCAGGGTGAAGACCAGAAAAAACTGGATGTTAT
CGCCAACAACATTATGATTGACACACTCAAAGCCAACCCTGCCGTTGCCG
GTTTGGCAAGCGAGGAAGAAGACACTTTCGTAAGTGCCGGTGAAAACGGA
CGCTATCTCGTCCTATTCGACCCTTTAGACGGATCGTCCAATATTGATGT
CAACATTTCCGTCGGTACGATTTTCTCCATTCTCGCCAAACCCGAAGGCG
CATTGGCAACCGAATCATTCCTTCAAACGGGCAGACAGCAGCTTGCCGCA
GGCTATGTCCTCTACGGGCCTCAAACCCAGCTCGTATTCACATTCGGACA
CGGCGTGTACGTATTTACACTCAATGCCGAAAACGAATTTGTGCTGACCA
AAGAAAACCCGAAAGTACCCGAAAGTACCAAAGAATTCGCCATCAATATG
TCTAACCGCCGCCACTGGCTACCCCCCGTTCAACAATACGTCGACGAGCT
CTTGGCGGGCGAAACCGGTACGCGCGGCAAAAACTACAATATGCGCTGGG
TAGCCAGTATGGTTGCCGAAATCCACCGCATCCTGATGCGCGGCGGCGTG
TTCATGTATCTGCAAGACAAACGCGACCCGTCCAAACCCGGCAAACTGCG
CCTGATGTACGAAGCCAACCCTATGGCCCTGATACTCGAACAGGCGGGCG
CATCGGCAAGCAACGCATATCAAGCCATGCTCGATATACAGCCCGAAAGC
CTGCACCAACGCGTCGCCGTCATTATGGGCAGCAGCGAAGAAGTGGATTA
CCTCAACCGTCTGCATTCAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy