Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0712 IGR0707 IGR0713 IGR0710 IGR0717 IGR0711 IGR0715 IGR0706 IGR0716.2 IGR0709 IGR0709.1 IGR0714 IGR0708 IGR0716 IGR0716.1 NG0854 NG0863 NG0861 folB, - NG0857 NG0855 ftsK, - NG0851 NG0865 crcB, - NG0853 NG0860 ggt, - NG0864.1 ggt, - NG0864 NG0858 NG0852 NG0859 f16p,fbp, - NG0862 glyA, - NG0866 NG0854 NG0863 NG0861 folB, - NG0857 NG0855 ftsK, - NG0851 NG0865 crcB, - NG0853 NG0860 ggt, - NG0864.1 ggt, - NG0864 NG0858 NG0852 NG0859 f16p,fbp, - NG0862 glyA, - NG0866 NG0863 NG0861 folB, - NG0857 NG0855 ftsK, - NG0851 NG0854 crcB, - NG0853 NG0860 ggt, - NG0864.1 ggt, - NG0864 NG0858 NG0852 NG0859 f16p,fbp, - NG0862 glyA, - NG0866 NG0865
* Calculated from Protein Sequence

Gene ID: NG0860

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
843665

Gene Stop:
844120

Gene Length:
456

Molecular Weight*:
17298

pI*:
11.60

Net Charge*:
14.53

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.860

Blast Summary:  PSI-Blast Search
No hit found in gapped BLAST.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG0860 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MPSEPFRRHLPSNKQNRAIHTPYRPVLHKTSIQKSEHAFHYTHGTNHTVQ
QHQTTGSRTHTLTDCVMLIGTFFTFQSQLLRNIFTLTAVLRQFRTANSRF
GTVTTSLDYGRIVADSIVGYRIFRSAGSKQNGTHSNNGNIFQVFHTCPII
SK

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGTCTGAACCCTTCAGACGGCATCTTCCGTCAAACAAACAAAACCG
GGCGATACACACTCCATATCGTCCGGTTCTGCATAAAACCAGTATTCAAA
AATCAGAACACGCTTTTCATTACACCCACGGTACCAACCACACCGTTCAG
CAGCATCAGACCACCGGCAGCCGTACCCATACCTTGACGGATTGCGTCAT
GCTTATTGGCACGTTTTTCACGTTCCAAAGCCAACTCCTCAGAAACATTT
TTACGTTGACGGCGGTGTTGCGCCAGTTCCGCACGGCTAATTCGCGCTTC
GGCACGGTTACGACCAGCCTTGATTACGGCCGAATCGTCGCCGATAGCAT
AGTTGGCTACAGAATTTTCAGAAGCGCAGGCAGCAAGCAAAACGGCACAC
ACAGCAACAACGGAAATATTTTTCAAGTTTTTCATACCTGTCCTATTATC
TCAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy