Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0707 IGR0702 IGR0706 IGR0705 IGR0703 IGR0704.1 IGR0704 NG0847 leu1, - NG0848 ftsK, - NG0851 crcB, - NG0853 NG0852 umpA,lgt, - NG0846 proB, - NG0849 proA, - NG0850 NG0847 leu1, - NG0848 ftsK, - NG0851 crcB, - NG0853 NG0852 umpA,lgt, - NG0846 proB, - NG0849 proA, - NG0850 Type: tandem, Name:  - 36 NG0847 leu1, - NG0848 ftsK, - NG0851 NG0852 umpA,lgt, - NG0846 proB, - NG0849 proA, - NG0850 crcB, - NG0853
* Calculated from Protein Sequence

Gene ID: NG0850

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
proA  

Definition:
gamma-glutamyl phosphate reductase

Gene Start:
834816

Gene Stop:
836075

Gene Length:
1260

Molecular Weight*:
44908

pI*:
5.80

Net Charge*:
-6.18

EC:
1.2.1.41  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  

Pathway: pathway table
Porphyrin and chlorophyll metabolism
Urea cycle and metabolism of amino groups

Secondary Evidence:
Omori,K., Suzuki,S., Imai,Y. and Komatsubara,S.
Analysis of the Serratia marcescens proBA operon and feedback control of proline biosynthesis.
J. Gen. Microbiol. 137 (Pt 3): 509-517 (1991)
[Medline: 91237315].

Comment:
For other 'pro' genes see NG0566 (proS) and NG1905 (proC).


From GenBANK (gi:130962): ProA catalyzes the NADPH dependent reduction of l-gamma-glutamyl 5-phosphate into l-glutamate 5-semialdehyde and phosphate. The product spontaneously undergoes
cyclization to form 1-pyrroline-5-carboxylate. The reaction: l-glutamate 5-semialdehyde + orthophosphate + NADP(+) = l-gamma-glutamyl 5-phosphate + NADPH. This is the proline
biosynthesis pathway; second step.

Oklahoma ID: NGO.850

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to gamma-glutamyl phosphate reductases; e.g. residues 12-419 are 49% similar to 12724615 of Lactococcus lactis.

NG0850 is orthologous to AE002457, N. meningitidis MC58 gamma-glutamyl phosphate reductase : residues 1-420 have 95% similarity to residues 1-420 in NG0850.


COGS Summary:  COGS Search
BeTs to 8 clades of COG0014
COG name: Gamma-glutamyl phosphate reductase (proline biosynthesis)
Functional Class:  E
The phylogenetic pattern of COG0014 is ----yqvCebrh-----l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000965 (Gamma-glutamyl phosphate reductase) with a combined E-value of 4.2e-146.
    IPB000965A    18-70
    IPB000965B    115-152
    IPB000965C    216-263
    IPB000965D    315-361
    IPB000965E    362-401
***** IPB002086 (Aldehyde dehydrogenase family) with a combined E-value of 8.4e-06.
    IPB002086C    195-215
    IPB002086D    225-268
    IPB002086E    296-349


ProDom Summary:  Protein Domain Search
Residues 26-419 are 49% similar to a (GAMMA-GLUTAMYL PHOSPHATE REDUCTASE GPR) protein domain (PD001968) which is seen in PROA_STRTR.



Paralogs:  Local Blast Search


NG0850 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
50
non-globular  
91  
187

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MSNTQKQLALAKAAKKSVNTADAEEKNRALLAMADSLEAAAEDILAANRL
DLKAAAGKIPDSMTDRLLLDGKRICAMADGIRAVAALPDPVGEILETSTL
PNGLEIVKKRVAMGVIGIIYESRPNVTSDAAALALKSGSAVVLRSGKDAF
QSARAIVAALKTGLAQTRIDPEAVQLIEDTGREGSYEMMRAKDYLDLLIP
RGGAGLIRAVVENAVVPVIETGTGIVHIYIDKDADWDKALRIVYNAKTGR
PSVCNSMEVLLVHEGIAADFLPKLERLLVRGRIEAGLPPVRFRLDPQAAR
YIGGEAAGADDFDTEFLDYILAVKTVASVEEAVGHIEARGTHHSDGIVTE
NRHAADYFTTHIDSAAVYINASTRFTDGGEFGLGCEMGISTQKLHARGPM
GLKELTSYKYIVQGTGQVRE

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAAACACACAAAAACAGCTTGCCCTTGCCAAAGCGGCAAAAAAATC
CGTCAACACGGCGGATGCGGAAGAAAAAAACCGCGCGCTGCTTGCTATGG
CGGACAGTCTGGAAGCGGCGGCGGAAGATATTTTGGCGGCAAACCGTTTG
GATTTGAAAGCGGCGGCAGGCAAAATTCCCGACAGCATGACCGACCGCCT
TTTGTTGGACGGCAAACGCATTTGCGCGATGGCGGACGGCATCAGGGCGG
TTGCCGCGCTGCCCGACCCCGTGGGCGAAATACTGGAAACCTCGACTCTG
CCCAACGGCTTGGAAATCGTCAAAAAGCGCGTGGCGATGGGCGTTATCGG
CATTATTTACGAAAGCCGCCCGAACGTTACTTCCGATGCGGCGGCTTTGG
CACTGAAAAGCGGCAGCGCGGTCGTACTCCGCAGCGGCAAAGATGCATTT
CAATCCGCACGCGCCATCGTTGCCGCCCTGAAAACGGGGTTGGCACAAAC
CCGCATCGACCCCGAAGCCGTACAGCTCATCGAAGACACAGGGCGTGAGG
GCAGTTACGAAATGATGAGGGCGAAAGATTATCTAGACCTGCTGATTCCG
CGCGGCGGGGCAGGGCTGATACGGGCGGTGGTTGAAAATGCCGTCGTGCC
GGTCATTGAAACGGGGACGGGCATCGTCCACATTTATATCGACAAGGACG
CGGATTGGGACAAGGCACTCCGTATCGTGTACAACGCCAAAACCGGCCGC
CCGTCCGTGTGCAACTCGATGGAAGTGCTGCTGGTGCATGAAGGCATTGC
TGCCGACTTCCTGCCCAAGCTCGAACGGCTGTTGGTTCGCGGCCGTATAG
AAGCCGGACTGCCGCCCGTCCGCTTCCGTTTGGATCCGCAGGCGGCGCGG
TATATCGGCGGCGAAGCGGCGGGTGCAGACGATTTCGATACCGAGTTTTT
AGACTACATCCTCGCCGTGAAAACCGTCGCTTCGGTTGAAGAGGCGGTCG
GGCACATCGAAGCCCGCGGCACGCACCATTCAGACGGCATCGTTACCGAA
AACCGCCACGCTGCGGACTATTTCACGACCCATATCGATTCTGCCGCCGT
GTATATCAACGCGTCCACGCGCTTCACCGACGGCGGCGAATTCGGCTTGG
GTTGCGAAATGGGCATCTCCACGCAAAAACTCCACGCCCGGGGCCCGATG
GGTTTGAAAGAGCTGACGAGTTACAAATACATCGTACAAGGCACGGGACA
GGTTAGGGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy