Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0701 IGR0702 IGR0705 IGR0703 IGR0704.1 IGR0704 NG0847 leu1, - NG0848 ftsK, - NG0851 umpA,lgt, - NG0846 proB, - NG0849 NG0845 proA, - NG0850 NG0847 leu1, - NG0848 ftsK, - NG0851 umpA,lgt, - NG0846 proB, - NG0849 NG0845 proA, - NG0850 Type: tandem, Name:  - 36 NG0847 leu1, - NG0848 ftsK, - NG0851 umpA,lgt, - NG0846 proB, - NG0849 NG0845 proA, - NG0850
* Calculated from Protein Sequence

Gene ID: NG0849

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
proB  

Definition:
gamma-glutamyl kinase

Gene Start:
833695

Gene Stop:
834579

Gene Length:
885

Molecular Weight*:
31224

pI*:
7.20

Net Charge*:
0.60

EC:
2.7.2.11  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  

Pathway: pathway table
Urea cycle and metabolism of amino groups

Secondary Evidence:
Deutch,A.H., Rushlow,K.E. and Smith,C.J.
Analysis of the Escherichia coli proBA locus by DNA and protein
sequencing
Nucleic Acids Res. 12 (15), 6337-6355 (1984)
MEDLINE: 84297232


Comment:


Blast Summary:  PSI-Blast Search
Residues 4-289 are 46% similar to Z99114, a glutamate 5-kinase from Bacillus subtilis.

Residues 1-294 are 44% similar to Z99110, a gamma-glutamyl kinase from Bacillus subtilis.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0263
COG name: Glutamate 5-kinase
Functional Class:  E
The phylogenetic pattern of COG0263 is ----YqvceBrh-----l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001057 (Glutamate 5-kinase) with a combined E-value of 4.3e-74.
    IPB001057A    27-52
    IPB001057B    72-107
    IPB001057C    145-178
    IPB001057D    203-235


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


NG0849 is paralogously related to NG0956 (aspartokinase, alpha and beta chains) (3e-07) and NG1973 (uridylate kinase (PyrH)) (3e-04).


Pfam Summary:  Pfam Search
Residues 4 to 234 (E-value = 1e-64) place NG0849 in the AA_kinase family which is described as Amino acid kinase family (PF00696)

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MKYKRIVFKVGTSSITRSDGSLSRGKIQTITRQLAALHHAGHELVLVSSG
AVAAGFGALGFKKRPVKIADKQASAAVGQGLLMEEYTANLSSDGIVSAQI
LLSRADFADKRRYQNAGGALSVLLQRRAIPIINENDTVSVEELKIGDNDT
LSAQVAAMIQADLLVLLTDIDGLYTGNPNSNPDAVRLDKIEHINHEIIEM
AGGSGSANGTGGMLTKIKAATIAAESGVPVYICSSLKPDSLAEAAEHQAD
GSFFVPRAKGLRTQKQWLAFYSESRGSVYVDEGAEHALSEQGKAC

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATACAAAAGAATCGTATTTAAAGTCGGCACATCTTCGATTACCCG
TTCGGACGGCAGCCTCTCGCGCGGCAAAATCCAAACCATCACCCGCCAGC
TTGCCGCATTGCATCATGCGGGACACGAGCTGGTCTTGGTGTCTTCCGGC
GCGGTTGCTGCAGGGTTCGGCGCGCTGGGTTTCAAAAAACGTCCGGTCAA
AATCGCCGACAAACAGGCTTCCGCCGCCGTCGGGCAGGGGCTGCTGATGG
AAGAATATACGGCAAACCTGTCTTCAGACGGCATCGTGTCCGCACAAATC
CTGCTCAGCCGTGCCGACTTTGCCGACAAACGCCGCTACCAAAATGCCGG
CGGCGCACTTTCCGTGCTGCTGCAACGCCGCGCGATTCCCATCATCAATG
AAAACGACACGGTTTCGGTTGAGGAGTTGAAAATCGGCGACAACGACACA
TTGAGTGCGCAAGTGGCGGCGATGATACAGGCAGACCTCTTGGTGCTGCT
GACCGACATAGACGGTCTTTACACCGGCAACCCGAACAGCAATCCCGATG
CCGTACGGCTGGACAAAATCGAACACATCAACCATGAAATCATCGAAATG
GCGGGCGGCTCGGGTTCGGCAAACGGCACGGGCGGTATGCTGACCAAAAT
CAAAGCGGCAACCATCGCCGCCGAATCCGGCGTACCGGTGTATATCTGTT
CCTCACTCAAACCCGATTCATTGGCCGAAGCCGCCGAACATCAGGCGGAC
GGCTCGTTTTTCGTCCCCCGTGCCAAAGGTTTGCGGACACAGAAGCAATG
GCTGGCGTTCTATTCCGAAAGCCGGGGCAGCGTTTATGTGGACGAAGGTG
CGGAACACGCTTTGTCCGAACAAGGGAAAGCCTGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy