Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0694 IGR0695 IGR0699 IGR0692 IGR0701 IGR0702 IGR0698 IGR0700 IGR0696 IGR0703 IGR0693 IGR0697 NG0843 NG0847 argB, - NG0844 leu1, - NG0848 NG0836 NG0840 NG0838 NG0837 gna1162, - NG0835 NG0841 NG0842 NG0839 umpA,lgt, - NG0846 NG0845 NG0843 NG0847 argB, - NG0844 leu1, - NG0848 NG0836 NG0840 NG0838 NG0837 gna1162, - NG0835 NG0841 NG0842 NG0839 umpA,lgt, - NG0846 NG0845 NG0843 NG0847 argB, - NG0844 leu1, - NG0848 NG0840 NG0837 gna1162, - NG0835 NG0841 NG0842 NG0839 umpA,lgt, - NG0846 NG0845 NG0836 NG0838
* Calculated from Protein Sequence

Gene ID: NG0844

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
argB  

Definition:
acetylglutamate kinase (NAGB)

Gene Start:
828485

Gene Stop:
827592

Gene Length:
894

Molecular Weight*:
31404

pI*:
5.70

Net Charge*:
-4.59

EC:
2.7.2.8  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  

Pathway: pathway table
Urea cycle and metabolism of amino groups

Secondary Evidence:
Reith,M. and Munholland,J.
Two amino-acid biosynthetic genes are encoded on the plastid genome of the red alga Porphyra umbilicalis.
Curr. Genet. 23 (1), 59-65 (1993)
Medline: 93153832.

Parsot,C., Boyen,A., Cohen,G.N. and Glansdorff,N.
Nucleotide sequence of Escherichia coli argB and argC genes:
comparison of N-acetylglutamate kinase and
N-acetylglutamate-gamma-semialdehyde dehydrogenase with homologous
nd analogous enzymes
Gene 68 (2), 275-283 (1988)
MEDLINE: 89121510

Gil,F., Ramon-Maiques,S., Marina,A., Fita,I. and Rubio,V.
N-acetyl-L-glutamate kinase from Escherichia coli: cloning of the
gene, purification and crystallization of the recombinant enzyme
and preliminary X-ray analysis of the free and ligand-bound forms
Acta Crystallogr. D 55, 1350-1352 (1999)

Ramon-Maiques,S., Marina,A., Gil-Ortiz,F., Fita,I. and Rubio,V.
Structure of acetylglutamate kinase, a key enzyme for arginine
biosynthesis and a prototype for the amino acid kinase enzyme
family, during catalysis
Structure 10, 329-342 (2002)


Comment:
See also: ArgA, NG0027; ArgC, NG0118, ArgD, NG0646; ArgF, NG1232; ArgG, NG1961; ArgH, NG0219, ArgJ, NG1194.

Oklahoma ID: NGO.844c

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to acetylglutamate kinases; e.g. residues 9-294 are 53% similar to 11347372 of Pseudomonas aeruginosa.

NG0844 is orthologous to AE002458, N. meningitidis MC58 acetylglutamate kinase : residues 1-298 have 97% similarity to residues 1-298 in NG0844.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0548
COG name: Acetylglutamate kinase
Functional Class:  E
The phylogenetic pattern of COG0548 is amtkyqvcEbr----------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001057 (Glutamate 5-kinase) with a combined E-value of 7.3e-39.
    IPB001057A    46-71
    IPB001057B    147-182
    IPB001057C    191-224
    IPB001057D    238-270


ProDom Summary:  Protein Domain Search
Residues 153-291 are 47% similar to a (KINASE TRANSFERASE BIOSYNTHESIS ASPARTOKINASE GLUTAMATE) protein domain (PD000447) which is seen in ARGB_METJA.

Residues 109-195 are 40% similar to a (ACETYLGLUTAMATE KINASE NAG AGK N-ACETYLGLUTAMATE) protein domain (PD102707) which is seen in ARGB_CORGL.

Residues 28-107 are 52% similar to a (KINASE ACETYLGLUTAMATE NAG AGK) protein domain (PD003894) which is seen in ARGB_METJA.



Paralogs:  Local Blast Search


NG0844 is paralogously related to NG0027 (N-acetylglutamate synthetase; amino acid N-acetyltransferase) (6e-22).


Pfam Summary:  Pfam Search
Residues 29 to 270 (E-value = 4e-52) place NG0844 in the AA_kinase family which is described as Amino acid kinase family (PF00696)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
53  
69
non-globular  
135  
298
transmembrane  
276  
292

PDB Hit:
No hits to the PBD database.

Gene Protein Sequence:
MEFENIISAADKARILAEALPYIRRFSGSVAVIKYGGNAMTEPALKEGFA
RDVVLLKLVGIHPVIVHGGGPQINAMLEKVGKKGEFVQGMRVTDKETMDI
VEMVLGGHVNKEIVSMINTYGGHAVGVSGRDDHFIKAKKLLVDTPEQNSV
DIGQVGTVESIDTGLVKGLIERGCIPVVAPVGVGEKGEAFNINADLVAGK
LAEELNAEKLLMMTNIAGVMDKTGNLLTKLTPKRIDGLIADGTLYGGMLP
KIASAVEAAVNGVKATHIIDGRLPNALLLEIFTDAGIGSMILGRGEDA

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAGTTTGAAAACATTATTTCCGCCGCCGACAAGGCGCGTATCCTTGC
CGAAGCACTGCCTTACATCCGCCGGTTTTCCGGTTCGGTCGCCGTCATCA
AGTATGGCGGCAACGCGATGACCGAACCTGCCTTGAAAGAAGGGTTTGCC
CGCGATGTCGTGCTGCTGAAGCTGGTCGGCATTCATCCCGTCATCGTTCA
CGGCGGCGGGCCGCAGATCAATGCGATGCTTGAAAAAGTCGGCAAAAAGG
GCGAATTTGTCCAAGGAATGCGCGTTACCGACAAAGAGACGATGGATATT
GTCGAAATGGTATTGGGCGGGCACGTCAACAAGGAAATCGTGTCGATGAT
TAACACATATGGAGGGCACGCGGTCGGCGTGAGCGGGCGCGACGACCATT
TCATTAAGGCGAAGAAACTTTTGGTCGATACGCCCGAACAGAATAGCGTG
GACATCGGACAGGTCGGTACGGTGGAAAGCATCGATACCGGTTTGGTTAA
AGGGCTGATAGAACGCGGCTGCATTCCCGTCGTCGCCCCCGTCGGCGTAG
GTGAAAAAGGCGAAGCGTTCAACATCAACGCCGATTTGGTGGCAGGCAAA
TTGGCGGAAGAATTGAACGCCGAAAAACTCTTGATGATGACGAATATCGC
CGGTGTGATGGACAAAACGGGCAATCTGCTGACCAAACTCACGCCGAAAC
GGATTGATGGGCTGATTGCCGACGGCACGCTGTATGGCGGTATGCTGCCG
AAAATCGCTTCTGCGGTCGAAGCCGCCGTCAACGGTGTGAAAGCCACGCA
CATCATCGACGGCAGGTTGCCCAACGCGCTTTTGCTGGAAATCTTTACCG
ATGCCGGTATCGGGTCGATGATTTTAGGCAGAGGGGAAGATGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy