Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0678 IGR0684 IGR0685 IGR0676 IGR0682 IGR0679 IGR0686 IGR0680 IGR0677.1 IGR0681 IGR0677 IGR0683 NG0817 NG0828 NG0823 NG0818 NG0816 NG0824 NG0827 NG0826 trmH,spoU, - NG0819 accA, - NG0821 mesJ, - NG0820 mpl, - NG0815 hscA, - NG0829 hslR, - NG0822 NG0817 NG0828 NG0823 NG0818 NG0816 NG0824 NG0827 NG0826 trmH,spoU, - NG0819 accA, - NG0821 mesJ, - NG0820 mpl, - NG0815 hscA, - NG0829 hslR, - NG0822 NG0818 NG0816 NG0824 NG0827 NG0826 trmH,spoU, - NG0819 accA, - NG0821 mesJ, - NG0820 mpl, - NG0815 hscA, - NG0829 fdx, - NG0825 fdx, - NG0825 NG0817 NG0828 NG0823 hslR, - NG0822
* Calculated from Protein Sequence

Gene ID: NG0821

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
accA  

Definition:
acetyl-CoA carboxylase carboxyl transferase alpha subunit

Gene Start:
812872

Gene Stop:
811916

Gene Length:
957

Molecular Weight*:
35407

pI*:
7.00

Net Charge*:
0.00

EC:
6.4.1.2  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Fatty acid biosynthesis (path 1)
Propanoate metabolism
Pyruvate metabolism
Tetracycline biosynthesis

Secondary Evidence:
Li,S.J. and Cronan,J.E. Jr.
The genes encoding the two carboxyltransferase subunits of
Escherichia coli acetyl-CoA carboxylase
J. Biol. Chem. 267 (24), 16841-16847 (1992)
M: 92380982


Comment:
Oklahoma ID: NGO.821c

For the beta subunit see NG0249.

Blast Summary:  PSI-Blast Search
NG0821 is orthologous to AE002465, N. meningitidis MC58 acetyl-CoA carboxylase, carboxyl transferase alpha subunit: residues 1-319 have 98% similarity to residues 1-319 in NG0821.

Residues 5-314 are 64% similar to AccA protein in E. coli (398993).


COGS Summary:  COGS Search
BeTs to 11 clades of COG0825
COG name: Acetyl-CoA carboxylase alpha subunit
Functional Class:  I
The phylogenetic pattern of COG0825 is a--kyqvceBRhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR01069 (Acetyl-CoA carboxylase carboxyl transferase alpha subunit signature) with a combined E-value of 2e-61.
    PR01069A    88-99
    PR01069B    113-131
    PR01069C    134-150
    PR01069D    153-166
    PR01069E    169-182
    PR01069F    197-206


ProDom Summary:  Protein Domain Search
Residues 5-97 are 62% similar to a (TRANSFERASE A CARBOXYLASE ALPHA) protein domain (PD004951) which is seen in ACCA_HAEIN.

Residues 98-276 are 62% similar to a (CARBOXYLASE LIGASE TRANSFERASE SUBUNIT PROTEIN ALPHA A) protein domain (PD001720) which is seen in ACCA_HAEIN.



Paralogs:  Local Blast Search


NG0821 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 148 (E-value = 1.1e-96) place NG0821 in the ACCA family which is described as Acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit (PF03255)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
12  
50

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MKPVFLDFEQPIAELTNKIDELRFVQDESAVDISDEIHRLQKKSNDLTKS
IFSKLTPAQISQVSRHPQRPYTLDYIDALFTDFEELHGDRHFADDHAIVG
GLARFNGQSVVVVGHQKGRDTKEKIRRNFGMPRPEGYRKALRLMKTAEKF
GLPVMTFIDTPGAYPGIGAEERGQSEAIGKNLYELTRLRVPVLCTVIGEG
GSGGALAVAVGDYVNMLQYSTYSVISPEGCASILWKTAEKAADAAQALGI
TADRLQKLDLVDTVIKEPLGGAHRDFGQTMKNVKAVLEKQLHEAQSIPLA
DLLSRRFDRIMAYGKFSEQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACCTGTTTTTTTGGATTTTGAACAACCCATAGCCGAACTGACCAA
CAAAATCGATGAGCTGCGTTTCGTCCAAGACGAGTCTGCCGTCGATATTT
CGGACGAAATACACCGTTTGCAGAAAAAAAGCAACGATTTGACCAAATCG
ATTTTCAGCAAACTCACACCCGCTCAAATTTCACAGGTTTCCCGGCATCC
GCAGCGTCCCTATACTTTGGATTACATTGACGCGCTGTTTACCGATTTTG
AAGAGCTGCACGGCGACCGCCACTTTGCCGACGATCATGCGATTGTCGGC
GGATTGGCGCGTTTCAACGGACAAAGCGTTGTGGTCGTCGGGCATCAGAA
AGGGCGCGACACCAAAGAAAAAATCCGCCGCAACTTCGGTATGCCCCGTC
CTGAAGGCTACCGCAAAGCCCTGCGCCTGATGAAAACGGCGGAAAAATTC
GGCTTGCCCGTCATGACCTTTATCGATACGCCGGGCGCGTATCCCGGCAT
CGGCGCGGAAGAACGCGGGCAGTCGGAAGCCATCGGCAAAAACCTGTACG
AACTGACCCGACTGCGCGTTCCCGTTTTGTGTACCGTCATCGGCGAAGGC
GGTTCGGGCGGTGCGTTGGCGGTCGCCGTAGGCGATTACGTCAATATGCT
GCAATATTCGACCTATTCCGTTATTTCCCCCGAAGGCTGTGCTTCGATTT
TGTGGAAAACCGCCGAAAAGGCGGCTGATGCGGCACAGGCTTTGGGTATT
ACTGCCGACCGCCTGCAAAAGCTGGACTTGGTCGATACCGTCATTAAAGA
GCCTTTGGGTGGTGCGCATAGGGATTTCGGGCAAACCATGAAAAACGTAA
AAGCCGTTTTGGAAAAACAACTGCACGAAGCGCAAAGCATCCCGCTTGCC
GATTTGCTTTCGCGCCGTTTCGACCGCATTATGGCTTACGGCAAATTTTC
GGAACAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy