Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0678 IGR0674 IGR0675 IGR0672 IGR0676 IGR0679 IGR0680 IGR0673 IGR0677.1 IGR0677 NG0817 NG0814 NG0818 NG0816 trmH,spoU, - NG0819 NG0811 accA, - NG0821 bioB, - NG0813 mesJ, - NG0820 mpl, - NG0815 NG0810 NG0812 dad,ilvD, - NG0809 NG0817 NG0814 NG0818 NG0816 trmH,spoU, - NG0819 NG0811 accA, - NG0821 bioB, - NG0813 mesJ, - NG0820 mpl, - NG0815 NG0810 NG0812 dad,ilvD, - NG0809 Type: tandem, Name:  - 35 NG0814 NG0818 NG0816 trmH,spoU, - NG0819 NG0811 accA, - NG0821 bioB, - NG0813 mesJ, - NG0820 mpl, - NG0815 NG0817 NG0810 NG0812 dad,ilvD, - NG0809
* Calculated from Protein Sequence

Gene ID: NG0815

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mpl  

Definition:
UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase

Gene Start:
808477

Gene Stop:
807104

Gene Length:
1374

Molecular Weight*:
49436

pI*:
6.70

Net Charge*:
-2.69

EC:
6.3.2.-  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Tryptophan metabolism
Ubiquinone biosynthesis

Secondary Evidence:
Mengin-Lecreulx,D., van Heijenoort,J. and Park,J.T. Identification of the mpl gene encoding UDP-N-acetylmuramate: L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase inEscherichia coli and its role in recycling of cell wallpeptidoglycan. J. Bacteriol. 178 (18): 5347-5352 (1996) [Medline: 96404780].

Comment:
From GenBANK (gi:3219995): This protein reutilizes the intact tripeptide l-alanyl-gamma-d-glutamyl-meso-diaminopimelate by linking it to UDP-n-acetylmuramic acid, involved in cell wall synthesis, specifically the last step of the murein tripeptide recycling pathway. It belongs to the MurCDEF family.

Oklahoma ID: NGO.815c

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to UDP-N-acetylmuramate--alanine ligases; e.g. residues 22-458 are 58% similar to 11356306 of Vibrio cholerae.

NG0815 is orthologous to AE002466, N. meningitidis MC58 UDP-N-acetylmuramate: L-alanyl-gamma- D-glutamyl-meso-diaminopimelate ligase : residues 1-458 have 93% similarity to residues 1-458 in NG0815.


COGS Summary:  COGS Search
BeTs to 11 clades of COG0773
COG name: UDP-N-acetylmuramate-alanine ligase
Functional Class:  M
The phylogenetic pattern of COG0773 is -----qvcEbrHuj--olinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 22-218 are 62% similar to a (LIGASE SYNTHETASE PEPTIDOGLYCAN SYNTHESIS) protein domain (PD001083) which is seen in MPL_ECOLI.

Residues 402-457 are 55% similar to a (UDP-N-ACETYLMURAMATE:L-ALANYL-GAMMA-D-GLUTAMYL-MESO-) protein domain (PD039275) which is seen in MPL_ECOLI.

Residues 275-394 are 61% similar to a (LIGASE SYNTHETASE PEPTIDOGLYCAN SYNTHESIS) protein domain (PD001216) which is seen in MPL_ECOLI.



Paralogs:  Local Blast Search


NG0815 is paralogously related to NG1532 (UDP-N-acetylmuramate--alanine ligase (MurC)) (2e-36), NG1535 (UDP-N-acetylmuramoylalanine--D-glutamate ligase (MurD)) (1e-09), NG1539 (UDP-MurNAc-pentapeptide synthetase (MurF)) (7e-08) and NG1541 (UDP-N-acetylmuramyl-tripeptide synthetase (MurE)) (3e-04).


Pfam Summary:  Pfam Search
Residues 39 to 312 (E-value = 7e-36) place NG0815 in the Mur_ligase family which is described as Mur ligase family, catalytic domain (PF01225)
Residues 321 to 411 (E-value = 2e-18) place NG0815 in the Mur_ligase_C family which is described as Mur ligase family, glutamate ligase domain (PF02875)

Structural Feature(s):
Feature Type  Start  Stop
cleavable N-terminal sequence  
1  
21

PDB Hit:
pdb|1J6U|1J6U-A CRYSTAL STRUCTURE OF 75.3 2e-14
pdb|1GG4|1GG4-A CRYSTAL STRUCTURE OF ESCHERICHIA COLI 49.2 2e-06
pdb|1E8C|1E8C-A STRUCTURE OF MURE THE UDP-N-ACETYLMURAMYL 44.1 5e-05
pdb|1E0D|1E0D-A UDP-

Gene Protein Sequence:
MKHIHIIGIGGTFMGGIAAIAKEAGFKVSGCDAKMYPPMSTQLEALGIGV
HEGFDAAQLEEFQADIYVIGNVARRGMDVVEAILNRGLPYISGPQWLAEN
VLHHHWVLGVAGTHGKTTTASMLAWVLEYAGLAPGFLIGGVPENFGVSAR
LPQTPRQDPNSKSPFFVIEADEYDTAFFDKRSKFVHYRPRTAVLNNLEFD
HADIFADLGAIQTQFHHLVRTVPSEGLIVCNGQQQSLQDTLDKGCWTPVE
KFGTGHGWQIGEVNADGSFDVLLDGKKAGHVAWDLMGGHNRMNALAVIAA
ARHAGVDVQTACEALGAFKNVKRRMEIKGTANGITVYDDFAHHPTAIETT
IQGLRQRVGGARILAVLEPRSNTMKLGTMKSALPASLKEADQVFCYAGGA
DWDVAEALAPLGCRLRVGKDFDTFVAEIVKNARTGDHILVMSNGGFGGIH
TKLLDALR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACACATCCACATTATCGGTATCGGCGGCACGTTTATGGGCGGGAT
TGCCGCCATTGCCAAAGAAGCCGGGTTCAAAGTCAGCGGTTGCGACGCGA
AGATGTATCCGCCGATGAGCACCCAGCTCGAAGCCTTGGGCATAGGCGTA
CACGAAGGCTTCGATGCCGCGCAGTTGGAAGAATTTCAAGCCGATATTTA
CGTCATCGGCAATGTCGCCAGGCGCGGGATGGATGTGGTCGAGGCGATTT
TGAACCGTGGGCTGCCTTATATTTCCGGCCCGCAATGGCTGGCTGAAAAC
GTGCTGCACCATCATTGGGTACTCGGCGTGGCAGGGACGCACGGCAAAAC
GACCACCGCGTCCATGCTCGCCTGGGTCTTGGAATATGCCGGACTCGCGC
CGGGCTTCCTCATCGGCGGTGTACCGGAAAATTTCGGCGTTTCCGCCCGC
CTACCGCAAACGCCGCGTCAAGACCCGAACAGCAAATCGCCGTTTTTCGT
CATCGAAGCCGACGAATACGACACCGCCTTTTTCGACAAACGCTCCAAAT
TCGTGCATTATCGCCCGCGTACCGCCGTGTTGAACAATCTGGAATTCGAC
CACGCCGACATCTTCGCCGACTTGGGCGCGATACAGACCCAGTTCCACCA
CCTCGTGCGCACCGTACCATCCGAAGGCCTCATCGTCTGCAACGGACAGC
AGCAAAGCCTGCAAGATACTTTGGACAAAGGCTGCTGGACGCCGGTGGAA
AAATTCGGCACCGGACACGGCTGGCAGATTGGTGAAGTCAATGCCGACGG
CTCGTTCGACGTATTGCTTGACGGCAAAAAAGCCGGACACGTCGCATGGG
ATTTGATGGGCGGACACAACCGCATGAACGCGCTCGCCGTCATCGCTGCC
GCACGCCATGCCGGAGTCGATGTTCAGACGGCCTGCGAAGCCTTGGGTGC
GTTTAAAAACGTCAAACGCCGCATGGAAATCAAAGGCACGGCAAACGGCA
TCACCGTTTACGACGATTTCGCCCACCACCCGACCGCCATCGAAACCACG
ATTCAAGGTTTGCGCCAACGTGTCGGCGGCGCGCGCATCCTCGCCGTCCT
CGAGCCGCGTTCCAACACCATGAAACTCGGCACGATGAAGTCCGCCCTGC
CCGCAAGCCTCAAAGAAGCCGACCAAGTGTTCTGCTACGCCGGCGGCGCG
GACTGGGACGTTGCCGAAGCCCTCGCGCCTTTGGGCTGCAGGCTGCGCGT
CGGTAAAGATTTCGATACCTTCGTTGCCGAAATTGTGAAAAACGCCCGAA
CCGGCGACCATATTTTGGTGATGAGCAACGGCGGTTTCGGCGGAATACAC
ACCAAACTGCTGGACGCTTTGAGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy