Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0678 IGR0674 IGR0675 IGR0672 IGR0676 IGR0679 IGR0673 IGR0671.3 IGR0677.1 IGR0677 NG0817 NG0814 NG0818 NG0816 trmH,spoU, - NG0819 NG0811 bioB, - NG0813 mesJ, - NG0820 mpl, - NG0815 NG0810 NG0812 cysI, - NG0808 dad,ilvD, - NG0809 NG0817 NG0814 NG0818 NG0816 trmH,spoU, - NG0819 NG0811 bioB, - NG0813 mesJ, - NG0820 mpl, - NG0815 NG0810 NG0812 cysI, - NG0808 dad,ilvD, - NG0809 Type: tandem, Name:  - 35 NG0814 NG0818 NG0816 trmH,spoU, - NG0819 NG0811 bioB, - NG0813 mesJ, - NG0820 mpl, - NG0815 NG0817 NG0810 NG0812 cysI, - NG0808 dad,ilvD, - NG0809
* Calculated from Protein Sequence

Gene ID: NG0813

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
bioB  

Definition:
biotin synthase

Gene Start:
806894

Gene Stop:
805845

Gene Length:
1050

Molecular Weight*:
38769

pI*:
5.30

Net Charge*:
-8.76

EC:
2.8.1.6  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Biotin  

Pathway: pathway table
Biotin metabolism

Secondary Evidence:
Sakurai,N., Imai,Y., Masuda,M., Komatsubara,S. and Tosa,T. Molecular breeding of a biotin-hyperproducing Serratia marcescens strain. Appl. Environ. Microbiol. 59 (10): 3225-3232 (1993) [Medline: 94071435].

Otsuka,A.J., Buoncristiani,M.R., Howard,P.K., Flamm,J., Johnson,C.,Yamamoto,R., Uchida,K., Cook,C., Ruppert,J. and Matsuzaki,J. The Escherichia coli biotin biosynthetic enzyme sequences predicted from the nucleotide sequence of the bio operon. J. Biol. Chem. 263 (36): 19577-19585 (1988) [Medline: 89066784].

Comment:
Oklahoma ID: NGO.813c

For other 'bio' genes, see NG0309 (bioD), NG0308 (bioA), NG1481 (bioC), NG1483 (bioF), NG1725 (bioH).

From GenBANK (gi:2506981): This protein catalyzes the reaction: dethiobiotin + (S) = biotin, the last step in the biotin biosynthesis pathway. It belongs to the biotin and lipoic acid synthetases family.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to biotin synthases; e.g. residues 16-328 are 78% similar to 1168665 of Haemophilus influenzae.

NG0813 is orthologous to AE002466, N. meningitidis MC58 biotin synthetase : residues 1-350 have 98% similarity to residues 1-350 in NG0813.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0502
COG name: Biotin synthase and related enzymes
Functional Class:  H
The phylogenetic pattern of COG0502 is -MT-yqvcebrhuj-----n-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002684 (Biotin synthase) with a combined E-value of 4.1e-108.
    IPB002684A    69-80
    IPB002684B    101-120
    IPB002684C    139-185
    IPB002684D    188-224
    IPB002684E    232-248
    IPB002684F    270-281
    IPB002684G    307-317


ProDom Summary:  Protein Domain Search
Residues 23-326 are 79% similar to a (PROTEIN SYNTHETASE SYNTHASE IRON-SULFUR BIOTIN) protein domain (PD003026) which is seen in BIOB_HAEIN.



Paralogs:  Local Blast Search


NG0813 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 63 to 225 (E-value = 5.2e-31) place NG0813 in the Radical_SAM family which is described as Radical SAM superfamily (PF04055)
Residues 236 to 328 (E-value = 6.3e-44) place NG0813 in the BATS family which is described as Biotin and Thiamin Synthesis associated domain (PF06968)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MTVSPVALRRKTECKPHPTARYWKKCDVEALFGLPFLELVYQAAEVHRQN
FNPREIQLSTLLSIKTGGCPEDCAYCPQSAHHNTNLGKEQMMDVDEIVEK
AKIAKSRGASRFCMGAAWRGPKPKDVETVSAIIKAVKGLGMETCGTFGML
EEGMAEDLKEAGLDYYNHNLDTDPDRYNDIIHTRRHEDRMDTLGKVRNAG
LKVCCGGIVGMNETRAERAGLIASLANLDPQPESVPINRLVKVEGTPLAD
AEDLDWTEFVRTVSVARITMPQSYVRLSAGRSNMPEAMQAMCFMAGANSI
FYGDKLLTTGNPDEDGDRILMEKLNLYPLQFEPEGEVAEVEKASGIKADY


Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGTATCCCCCGTCGCCTTGCGCCGTAAGACCGAGTGCAAGCCTCA
TCCCACCGCGCGCTATTGGAAAAAATGCGATGTCGAGGCACTTTTCGGAC
TGCCGTTTTTAGAACTTGTCTATCAGGCGGCAGAAGTCCACCGCCAAAAT
TTCAACCCGCGCGAAATCCAGCTTTCCACGCTGTTGTCCATCAAAACCGG
CGGTTGTCCCGAAGATTGCGCCTACTGTCCGCAATCAGCGCACCACAACA
CCAATTTGGGCAAAGAGCAGATGATGGATGTGGATGAAATCGTCGAAAAA
GCCAAAATCGCCAAATCGCGCGGCGCAAGCCGGTTTTGTATGGGCGCGGC
ATGGCGCGGCCCCAAACCCAAAGACGTGGAGACGGTTTCCGCAATCATCA
AAGCCGTCAAGGGCTTAGGTATGGAAACCTGCGGCACGTTCGGTATGCTC
GAAGAAGGTATGGCGGAAGACTTGAAAGAGGCGGGCTTGGATTATTACAA
CCACAACCTCGACACCGACCCCGACCGCTACAACGACATCATCCACACAC
GCCGGCACGAAGACCGTATGGATACCTTGGGCAAAGTCCGCAACGCCGGT
TTGAAAGTCTGCTGCGGCGGCATCGTCGGGATGAACGAAACCCGCGCCGA
ACGCGCCGGGCTGATTGCCAGCCTCGCCAACCTCGACCCGCAGCCCGAAA
GCGTGCCGATTAACCGGTTGGTCAAAGTGGAAGGCACGCCGCTTGCCGAT
GCCGAAGATTTGGATTGGACCGAATTTGTCCGTACGGTTTCCGTAGCGCG
GATTACGATGCCGCAAAGTTATGTCCGCCTCTCGGCAGGGCGCAGCAATA
TGCCTGAAGCGATGCAGGCGATGTGCTTCATGGCGGGTGCGAACTCGATT
TTTTACGGCGACAAGCTGTTGACCACAGGCAATCCTGATGAGGACGGCGA
TAGAATCCTGATGGAAAAGCTTAACCTGTATCCCTTGCAGTTTGAGCCGG
AAGGCGAGGTCGCCGAAGTGGAAAAAGCCTCCGGGATTAAAGCGGATTAT



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy