Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0672 IGR0673 IGR0671.2 IGR0670 IGR0671.3 IGR0671 IGR0671.1 NG0804 NG0811 bioB, - NG0813 cysI, - NG0807 NG0810 cybP, - NG0805 NG0812 cysN,nodP, - NG0806 cysI, - NG0808 dad,ilvD, - NG0809 NG0804 NG0811 bioB, - NG0813 cysI, - NG0807 NG0810 cybP, - NG0805 NG0812 cysN,nodP, - NG0806 cysI, - NG0808 dad,ilvD, - NG0809 Type: tandem, Name:  - 35 NG0804 NG0811 bioB, - NG0813 cysI, - NG0807 NG0810 cybP, - NG0805 NG0812 cysN,nodP, - NG0806 cysI, - NG0808 dad,ilvD, - NG0809
* Calculated from Protein Sequence

Gene ID: NG0807

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
cysI  

Definition:
NADPH-sulfite reductase hemoprotein beta component (fragment?)

Gene Start:
800794

Gene Stop:
801078

Gene Length:
285

Molecular Weight*:
10810

pI*:
9.90

Net Charge*:
3.18

EC:
1.8.1.2  1.8.7.1  

Functional Class:
Central intermediary metabolism; Sulfur metabolism  

Pathway: pathway table
Selenoamino acid metabolism
Sulfur metabolism

Secondary Evidence:
Gruez A, Pignol D, Zeghouf M, Covès J, Fontecave M, Ferrer JL, Fontecilla-Camps JC.
Four crystal structures of the 60 kDa flavoprotein monomer of the sulfite reductase indicate a disordered flavodoxin-like module.
J Mol Biol. 2000 May;299(1):199-212.
PMID: 10860732

Willson PJ, Gerlach GF, Klashinsky S, Potter AA.
Cloning and characterization of the gene coding for NADPH-sulfite reductase hemoprotein from Actinobacillus pleuropneumoniae and use of the protein product as a vaccine.
Can J Vet Res. 2001 Oct;65(4):206-12.
PMID: 11768126

Ostrowski,J., Wu,J.Y., Rueger,D.C., Miller,B.E., Siegel,L.M. and
Kredich,N.M.
Characterization of the cysJIH regions of Salmonella typhimurium
and Escherichia coli B. DNA sequences of cysI and cysH and a model
or the siroheme-Fe4S4 active center of sulfite reductase
hemoprotein based on amino acid homology with spinach nitrite
reductase
J. Biol. Chem. 264 (26), 15726-15737 (1989)

Crane,B.R., Siegel,L.M. and Getzoff,E.D.
Sulfite reductase structure at 1.6 A: evolution and catalysis for
reduction of inorganic anions
Science 270 (5233), 59-67 (1995)
MEDLINE: 96008578

Crane,B.R., Siegel,L.M. and Getzoff,E.D.
Structures of the siroheme- and Fe4S4-containing active center of
sulfite reductase in different states of oxidation: heme activation via reduction-gated exogenous ligand exchange
Biochemistry 36 (40), 12101-12119 (1997)
MEDLINE: 97461529


Comment:


Blast Summary:  PSI-Blast Search
Residues 1-88 are 63% similar to M23007, an NADPH-sulfite reductase hemoprotein component from Salmonella typhimurium.

Residues 1-88 are 62% similar to M23008, an NADPH-sulfite reductase hemoprotein component from Escherichia coli.

COGS Summary:  COGS Search
BeTs to 4 clades of COG0155
COG name: Sulfite reductase hemoprotein beta-component
Functional Class:  P
The phylogenetic pattern of COG0155 is a---yq-CebR----------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


NG0807 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MTVQAKTKGLAWQEKPLSDNERLKTESNFLRGTILDDLKDPLTGGFKGDN
FQLIRFHSMYEQDGRDIRTEAKLEPLKFMLLRCRLPAGSSNRPSG

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGTACAGGCCAAGACAAAAGGTTTGGCGTGGCAAGAAAAGCCGCT
ATCCGACAACGAACGTCTGAAAACCGAAAGCAATTTTTTACGCGGCACGA
TTTTGGACGATTTGAAAGACCCGCTCACGGGCGGCTTCAAAGGCGACAAC
TTCCAACTCATCCGCTTCCACAGTATGTATGAGCAGGATGGCCGCGACAT
CCGCACCGAGGCAAAACTCGAGCCCTTGAAATTTATGCTTTTGCGCTGCC
GGCTGCCGGCGGGATCATCAAACCGTCCCAGTGGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy