Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0666 IGR0661 IGR0663 IGR0659 IGR0665 IGR0662 IGR0664 IGR0660 NG0800 NG0796 rnr, - NG0801 NG0797 bfrA, - NG0794 bfrB, - NG0795 lipA, - NG0793 imdH, - NG0799 glnD, - NG0798 NG0800 NG0796 rnr, - NG0801 NG0797 bfrA, - NG0794 bfrB, - NG0795 lipA, - NG0793 imdH, - NG0799 glnD, - NG0798 NG0800 NG0796 rnr, - NG0801 NG0797 bfrA, - NG0794 bfrB, - NG0795 lipA, - NG0793 imdH, - NG0799 glnD, - NG0798 lipB, - NG0792 lipB, - NG0792
* Calculated from Protein Sequence

Gene ID: NG0798

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glnD  

Definition:
protein-PII uridylyltransferase (PII uridylyl-transferase) (uridylyl removing enzyme) (UTase)

Gene Start:
786348

Gene Stop:
788903

Gene Length:
2556

Molecular Weight*:
96959

pI*:
7.70

Net Charge*:
7.12

EC:
2.7.7.59  

Functional Class:
Translation; Protein modification and translation factors  

Pathway: pathway table

Secondary Evidence:
van Heeswijk,W.C., Rabenberg,M., Westerhoff,H.V. and Kahn,D.
The genes of the glutamine synthetase adenylylation cascade are not regulated by nitrogen in Escherichia coli.
Mol. Microbiol. 9 (3): 443-457 (1993)
[Medline: 94018640].

Hesketh A, Fink D, Gust B, Rexer HU, Scheel B, Chater K, Wohlleben W, Engels A.
The GlnD and GlnK homologues of Streptomyces coelicolor A3(2) are functionally dissimilar to their nitrogen regulatory system
counterparts from enteric bacteria.
Mol Microbiol. 2002 Oct;46(2):319-30.
PMID: 12406211

Perlova O, Nawroth R, Zellermann EM, Meletzus D.
Isolation and characterization of the glnD gene of Gluconacetobacter diazotrophicus, encoding a putative
uridylyltransferase/uridylyl-removing enzyme.
Gene. 2002 Sep 4;297(1-2):159-68.
PMID: 12384297

Comment:
From GenBANK (gi:12230934): This protein modifies, by uridylylation or deuridylylation the PII (GlnB) regulatory protein by the reaction: UTP + [protein-PII] = pyrophosphate + uridylyl-[protein-PII]. It belongs to the GlnD family.

For other 'gln' genes, see NG0269 (glnQ), NG0374 (glnQ), NG2011 (glnM), NG1182 (glnB), NG1218 (glnS), NG1600 (glnA), NG1758
(glnE), NG2013 (glnQ), NG2012 (glnP).

Oklahoma ID: NGO.798

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to uridylyltransferases; e.g. residues 6-852 are 32% similar to 12230934 of Pseudomonas aeruginosa.

NG0798 is orthologous to AE002468, N. meningitidis MC58 protein-PII uridylyltransferase: residues 1-852 have 95% similarity to residues 1-852 in NG0798.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 40-437 are 33% similar to a (TRANSFERASE URIDYLYL ENZYME) protein domain (PD010199) which is seen in NFRX_AZOVI.

Residues 673-851 are 29% similar to a (TRANSFERASE PROTEIN URIDYLYL ENZYME) protein domain (PD004188) which is seen in GLND_ECOLI.

Residues 456-524 are 49% similar to a (TRANSFERASE ENZYME NUCLEOTIDYLTRANSFERASE PROTEIN-PII) protein domain (PD014387) which is seen in GLND_HAEIN.

Residues 525-618 are 44% similar to a (TRANSFERASE ENZYME NUCLEOTIDYLTRANSFERASE PROTEIN-PII) protein domain (PD009537) which is seen in NFRX_AZOVI.



Paralogs:  Local Blast Search


NG0798 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 436 to 558 (E-value = 2.6e-10) place NG0798 in the HD family which is described as HD domain (PF01966)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
46
coil-coil  
145  
172

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MPENLSSALETFKQQRNAAEAHYLKANRVSVFFREYTAAVETLLAALWAE
HFQNSALCLMAVGGFGRGEPYPCSDVDLAVVSPAPLSDGIQEQIARFIQT
LWDCKLMPSVKSGSVDELCESVRDDITGDTAFLEARFLFGNRQTADELAE
KMNVQRNVAAFIEAKLVEMEHRHAKSQGSGAVLEPNIKSCPGGLRDIHTL
LWIAKAQGLAANLPDLLKQRILTRAEAGMLSHGYRRLAHIRIRLHLNAKR
AEDRLLFDLQPQVAESMGYQDENRRRQSEELMRVFYRAVKTVKQLGGILT
PMLRSRVSSTPVRVTLRIDDDYIQVNNQIAARHTDIFFRRPEHIFKIVEI
MQQRNDITALEPQTLRAWWGATRKINRSFYQNSENRRRFAGFFRSGNGLT
QTLRFLNLYGVLGRYLPAWEKIVGLLQHDLFHIYPVDDHILAVVRNVRRL
ALDMHSHELPYASALMQSFEKQDILYLAAFFHDIAKGRGGDHAVQGIADA
RQFAADHFLTEEESDLLAWLVENHLLMSAVAQKEDIQDPGVLDAFCKRVQ
THERLSALYLLTISDIRGTNPKLWNAWRASLLESLFHAAGRCLAGNDGNP
HALFGRRRQEAADLLTRAAVPEKQQKKLWNALGSAYFARHQSREILWHAA
NLVHDFEPPIVRSRILPQSDSFQVMVFMPNGPRLFARLCRIFSRHGFDIL
AARAFITEHDYILDTFIVQIPSQHAPEDYPDIQSALEAELNSFIHGHTVA
ETQSCNRRISRRSRYMPIAPSITITPEEDYPDRYSVEITAVNRPFLLADM
AEVFFAHNVSLRYAKISTLDERVEDSFTVFSPDLKNPKIQSSLKQALLEQ
LA

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTGAAAACCTGTCTTCAGCACTGGAAACCTTCAAACAGCAGCGCAA
TGCCGCCGAAGCGCATTATTTGAAAGCCAACCGCGTGTCGGTATTTTTCA
GAGAATACACGGCGGCAGTCGAAACCTTGCTGGCGGCATTGTGGGCAGAA
CATTTTCAAAACAGCGCGTTATGCCTGATGGCGGTAGGCGGCTTCGGGCG
CGGCGAACCGTATCCCTGTTCGGATGTGGATTTGGCGGTTGTCTCCCCTG
CCCCGCTTTCAGACGGCATTCAGGAACAGATTGCCCGATTTATCCAAACT
CTGTGGGATTGCAAACTAATGCCGTCTGTAAAAAGCGGCAGCGTTGACGA
ACTGTGCGAAAGCGTGCGCGACGATATTACGGGGGACACAGCGTTTTTAG
AGGCTAGGTTTTTGTTTGGCAACCGCCAAACAGCAGACGAATTGGCGGAA
AAAATGAACGTGCAACGCAATGTAGCGGCATTTATCGAAGCAAAATTGGT
GGAGATGGAACACCGCCACGCCAAATCGCAAGGTTCGGGGGCGGTGTTGG
AGCCGAATATCAAAAGCTGTCCGGGCGGTCTGCGCGACATCCACACCCTG
CTTTGGATAGCGAAGGCGCAAGGCTTGGCGGCCAACCTGCCCGACCTGCT
CAAACAGCGGATTTTGACACGTGCCGAAGCCGGTATGCTTTCGCACGGCT
ACCGCCGCCTCGCCCACATCCGCATCCGGCTGCATTTAAACGCCAAGCGC
GCCGAAGACCGCCTGCTTTTCGATTTGCAGCCGCAAGTTGCCGAAAGTAT
GGGTTATCAAGATGAAAACCGCCGCCGTCAAAGCGAAGAACTGATGCGCG
TGTTTTACCGTGCGGTCAAAACCGTCAAACAACTGGGCGGCATCCTCACG
CCCATGCTGCGAAGCCGCGTTTCCTCCACGCCGGTGCGCGTTACCCTGCG
GATTGACGACGACTACATCCAAGTCAACAACCAAATCGCCGCGCGGCACA
CCGATATTTTTTTCAGACGGCCCGAACACATTTTCAAAATCGTCGAAATC
ATGCAGCAGCGCAACGACATTACTGCGCTCGAACCGCAAACCCTGCGCGC
ATGGTGGGGGGCGACGCGCAAAATCAACCGCAGCTTCTACCAAAATTCTG
AAAACCGTCGCCGCTTCGCCGGTTTTTTCCGCAGCGGCAACGGACTGACC
CAAACCCTGCGCTTTCTCAACCTCTACGGCGTGTTGGGCCGCTATCTGCC
CGCGTGGGAAAAAATCGTCGGCCTGCTTCAACACGACTTGTTCCACATCT
ATCCCGTGGACGACCACATCCTTGCCGTCGTCCGCAACGTCCGCCGCCTT
GCCCTAGATATGCACAGCCATGAGCTGCCCTACGCCTCCGCGCTGATGCA
GTCCTTTGAAAAACAAGACATCCTCTACCTTGCCGCCTTCTTCCACGACA
TCGCCAAAGGACGCGGCGGCGACCATGCCGTACAAGGCATCGCAGACGCG
CGCCAATTTGCCGCCGACCACTTCCTGACCGAAGAAGAAAGCGACCTGCT
CGCCTGGCTGGTTGAAAACCACCTCCTTATGTCTGCCGTCGCCCAAAAAG
AAGACATCCAAGACCCCGGCGTACTCGATGCCTTCTGCAAACGCGTCCAA
ACCCACGAACGCCTCAGCGCGCTCTACCTCCTGACCATTTCCGACATACG
CGGCACCAATCCCAAGCTGTGGAACGCCTGGCGCGCCAGCCTGCTGGAAA
GCCTGTTCCACGCCGCCGGACGCTGCCTCGCAGGCAACGACGGCAACCCG
CACGCCCTCTTCGGCCGCCGCCGGCAGGAAGCCGCCGACTTACTTACCCG
CGCCGCCGTCCCCGAAAAACAGCAGAAAAAACTATGGAACGCGCTCGGTT
CCGCCTATTTCGCCCGCCATCAGTCCCGCGAAATCCTGTGGCACGCCGCC
AACCTCGTACACGACTTTGAACCCCCCATCGTCCGCAGCCGCATCCTACC
CCAAAGCGACAGCTTTCAAGTGATGGTCTTTATGCCCAACGGCCCGCGCC
TGTTCGCCCGCCTCTGCCGCATCTTCAGCCGCCACGGCTTCGATATCCTC
GCCGCCCGCGCCTTTATCACCGAACACGACTACATCCTCGACACCTTCAT
CGTGCAAATCCCCTCGCAGCACGCCCCCGAAGACTACCCCGACATCCAAA
GCGCGCTCGAAGCCGAACTCAACAGCTTTATCCACGGACACACCGTTGCC
GAAACCCAAAGCTGCAACCGCCGCATCAGCCGCCGCAGCCGCTATATGCC
TATTGCGCCAAGCATCACCATCACCCCCGAAGAAGACTATCCGGACCGGT
ATTCCGTCGAAATCACCGCCGTCAACCGCCCCTTCCTGCTCGCCGACATG
GCGGAAGTCTTCTTCGCCCACAACGTCAGCCTGCGCTACGCCAAAATCTC
CACGTTGGACGAACGCGTCGAAGACAGCTTTACCGTCTTCAGCCCCGACT
TGAAAAACCCAAAAATCCAGTCCTCATTGAAACAGGCTTTGCTGGAACAG
TTGGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy