Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0656 IGR0661 IGR0654 IGR0663 IGR0659 IGR0658 IGR0655 IGR0662 IGR0657 IGR0660 NG0790 NG0796 ung, - NG0786 NG0789 NG0791 NG0797 NG0787 NG0785 bfrA, - NG0794 bfrB, - NG0795 gna1220, - NG0788 lipA, - NG0793 glnD, - NG0798 NG0790 NG0796 ung, - NG0786 NG0789 NG0791 NG0797 NG0787 NG0785 bfrA, - NG0794 bfrB, - NG0795 gna1220, - NG0788 lipA, - NG0793 glnD, - NG0798 NG0790 NG0796 ung, - NG0786 NG0789 NG0797 NG0787 NG0785 bfrA, - NG0794 bfrB, - NG0795 gna1220, - NG0788 lipA, - NG0793 glnD, - NG0798 lipB, - NG0792 NG0791 lipB, - NG0792
* Calculated from Protein Sequence

Gene ID: NG0793

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lipA  

Definition:
lipoic acid synthetase LipA (lipoate biosynthesis protein A)

Gene Start:
783228

Gene Stop:
784208

Gene Length:
981

Molecular Weight*:
37034

pI*:
7.50

Net Charge*:
2.77

EC:
2.8.1.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Lipoate  

Pathway: pathway table

Secondary Evidence:
Hayden,M.A., Huang,I., Bussiere,D.E. and Ashley,G.W. The biosynthesis of lipoic acid. Cloning of lip, a lipoate biosynthetic locus of Escherichia coli. J. Biol. Chem. 267 (14): 9512-9515 (1992) [Medline: 92250596].

Reed,K.E. and Cronan,J.E. Jr. Lipoic acid metabolism in Escherichia coli: sequencing and functional characterization of the lipA and lipB genes. J. Bacteriol. 175 (5): 1325-1336 (1993) [Medline: 93186699].

Comment:
From GenBANK (gi:2507056): LipA functions in the synthesis of alpha-(+)-lipoic acid. It may be involved in the sulfur insertion chemistry in lipoate biosynthesis and belongs to the biotin and lipoic acid synthetases family.

See also LipB, NG0792.

Oklahoma ID: NGO.793

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to lipoic acid synthetases; e.g. residues 3-313 are 63% similar to 11350558 of Pseudomonas aeruginosa.

NG0793 is orthologous to AL162755, N. meningitidis Z2491 putative lipoic acid synthetase : residues 1-327 have 99% similarity to residues 1-327 in NG0793.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0320
COG name: Lipoate synthase
Functional Class:  H
The phylogenetic pattern of COG0320 is ----yq-Cebrh------inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003698 (Lipoate synthase) with a combined E-value of 6.3e-161.
    IPB003698A    36-46
    IPB003698B    64-101
    IPB003698C    113-155
    IPB003698D    163-172
    IPB003698E    186-204
    IPB003698F    228-277
    IPB003698G    279-309


ProDom Summary:  Protein Domain Search
Residues 57-89 are 78% similar to a (SYNTHETASE LIPOIC ACID LIPOATE) protein domain (PD005028) which is seen in LIPA_PELCA.

Residues 91-266 are 69% similar to a (PROTEIN SYNTHETASE SYNTHASE IRON-SULFUR BIOTIN) protein domain (PD003026) which is seen in LIPA_ECOLI.



Paralogs:  Local Blast Search


NG0793 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 86 to 250 (E-value = 5.2e-29) place NG0793 in the Radical_SAM family which is described as Radical SAM superfamily (PF04055)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MSEIKTDDPKRGIKLRGADKTARIPIKVVPLQEKLKKPEWIRAKLPSRKF
FEIKDILREQKMHTVCEEASCPNIGECFSKGTATFMIMGDICTRRCPFCD
VGHGRPNMLDPDEPKNLAESVKAMNLRYVVITSVDRDDLRDGGAQHFADC
IKAIRETSPNTKIEILVPDFRGRLDIALKILAETPPDVMNHNLETHPSLY
RKARPGANYQHSLDLLKRYKEMMPHIPTKSGIMVGLGETDEDVREIMRDM
RAHNIEMITIGQYLQPSDGHLPVLRYVTPEQFKIFEKEAYELGFTNAAIG
AMVRSSYHADEQAAEALRESHGGCGHH

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTGAAATCAAAACCGACGACCCCAAACGCGGCATCAAACTCAGAGG
CGCGGACAAAACCGCCCGCATCCCCATCAAAGTCGTCCCCCTTCAGGAAA
AACTGAAAAAGCCCGAATGGATACGCGCCAAACTCCCATCGCGCAAATTC
TTTGAAATCAAAGACATTTTGCGCGAACAAAAGATGCACACCGTTTGCGA
GGAAGCCTCCTGCCCCAACATCGGCGAATGCTTCAGCAAAGGCACGGCGA
CCTTCATGATTATGGGCGACATCTGCACCCGCCGCTGCCCGTTCTGCGAC
GTGGGACACGGCCGTCCGAATATGCTCGACCCCGACGAGCCGAAAAACCT
CGCAGAATCCGTCAAAGCCATGAACCTGCGTTACGTCGTCATCACCTCGG
TTGACCGCGACGACCTGCGCGACGGCGGCGCCCAACACTTCGCCGACTGC
ATCAAAGCCATCCGCGAAACCAGCCCGAACACCAAAATCGAAATCCTCGT
CCCCGACTTCCGAGGCCGCTTGGACATCGCACTGAAAATCCTTGCCGAAA
CCCCGCCCGACGTGATGAACCACAACTTGGAAACCCATCCGAGCCTGTAC
AGAAAAGCCCGTCCCGGTGCCAATTATCAACATTCTTTAGACTTATTAAA
ACGTTATAAAGAAATGATGCCGCATATCCCGACCAAATCCGGCATTATGG
TAGGCTTGGGCGAAACAGACGAAGACGTGCGTGAAATTATGCGCGATATG
CGGGCGCACAATATCGAGATGATTACCATCGGACAGTACCTCCAGCCTTC
AGACGGACACTTGCCTGTCTTGCGCTACGTTACACCCGAACAATTCAAAA
TATTTGAAAAAGAAGCATACGAACTGGGCTTTACCAATGCCGCCATCGGC
GCGATGGTACGTTCAAGTTACCATGCCGACGAACAGGCGGCGGAAGCCTT
ACGCGAAAGCCACGGCGGTTGCGGGCATCAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy