Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0656 IGR0650 IGR0654 IGR0652 IGR0659 IGR0658 IGR0649 IGR0655 IGR0651 IGR0657 IGR0648 IGR0653 NG0790 ung, - NG0786 NG0789 dhoM,hdh, - NG0779 NG0784 NG0791 NG0782 NG0780 NG0787 NG0785 NG0783 gna1220, - NG0788 lipA, - NG0793 yheS, - NG0781 NG0790 ung, - NG0786 NG0789 dhoM,hdh, - NG0779 NG0784 NG0791 NG0782 NG0780 NG0787 NG0785 NG0783 gna1220, - NG0788 lipA, - NG0793 yheS, - NG0781 NG0790 ung, - NG0786 NG0789 dhoM,hdh, - NG0779 NG0780 NG0787 NG0785 NG0783 gna1220, - NG0788 lipA, - NG0793 yheS, - NG0781 lipB, - NG0792 NG0791 NG0784 NG0782 lipB, - NG0792
* Calculated from Protein Sequence

Gene ID: NG0786

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ung  

Definition:
uracil-DNA glycosylase

Gene Start:
779523

Gene Stop:
778867

Gene Length:
657

Molecular Weight*:
24673

pI*:
8.20

Net Charge*:
3.78

EC:
3.2.2.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Varshney,U., Hutcheon,T. and van de Sande,J.H. Sequence analysis, expression, and conservation of Escherichia coli uracil DNA glycosylase and its gene (ung). J. Biol. Chem. 263 (16): 7776-7784 (1988) [Medline: 88227981].

Lundquist,A.J., Beger,R.D., Bennett,S.E., Bolton,P.H. and Mosbaugh,D.W. Site-directed mutagenesis and characterization of uracil-DNA glycosylase inhibitor protein. Role of specific carboxylic aminoacids in complex formation with Escherichia coli uracil-DNA glycosylase. J. Biol. Chem. 272 (34): 21408-21419 (1997) [Medline: 97407932].

Putnam,C.D., Shroyer,M.J., Lundquist,A.J., Mol,C.D., Arvai,A.S.,Mosbaugh,D.W. and Tainer,J.A. Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase. J. Mol. Biol. 287 (2): 331-346 (1999) [Medline: 99182421].

Xiao,G., Tordova,M., Jagadeesh,J., Drohat,A.C., Stivers,J.T. and Gilliland,G.L. Crystal structure of Escherichia coli uracil DNA glycosylase and its complexes with uracil and glycerol: structure and glycosylase mechanism revisited. Proteins 35 (1): 13-24 (1999) [Medline: 99188668].

Comment:
From GenBANK (gi:137035): Ung excises uracil residues from the DNA which can arise as a result of misincorporation of dump residues by DNA polymerase or due to deamination of cytosine. This cytoplasmic monomer belongs to the uracil-DNA glycosylase family.

Oklahoma ID: NGO.786c

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to uracil-DNA glycosylase; e.g. residues 1-219 are 68% similar to 1174879 of Haemophilus influenzae.

NG0786 is orthologous to AE002470, N. meningitidis MC58 uracil-DNA glycosylase : residues 1-219 have 96% similarity to residues 1-219 in NG0786.


COGS Summary:  COGS Search
BeTs to 8 clades of COG0692
COG name: Uracil DNA glycosylase
Functional Class:  L
The phylogenetic pattern of COG0692 is ----y---ebrhujgpo-in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002043 (Uracil-DNA glycosylase) with a combined E-value of 3.1e-82.
    IPB002043A    52-76
    IPB002043B    106-139
    IPB002043C    157-167
    IPB002043D    177-189
    IPB002043E    194-217


ProDom Summary:  Protein Domain Search
Residues 15-219 are 69% similar to a (GLYCOSYLASE URACIL-DNA DNA UDG) protein domain (PD001589) which is seen in UNG_HAEIN.



Paralogs:  Local Blast Search


NG0786 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 48 to 208 (E-value = 6.6e-85) place NG0786 in the UDG family which is described as Uracil DNA glycosylase superfamily (PF03167)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1EUG|1EUG-A CRYSTAL STRUCTURE OF ESCHERICHIA COLI URACIL DNA312.0 4e-86
pdb|1FLZ|1FLZ-A URACIL DNA GLYCOSYLASE WITH UAAP 310.0 1e-85
pdb|2EUG|2EUG-A CRYSTAL STRUCTURE OF ESCHERICHIA COLI URACIL DNA310.0 1e-85
pdb|1EUI|1EUI-A ESCH

Gene Protein Sequence:
MDTWHDALGGEKQQPYFQEILNAVRQERLSGQIIYPPEADVFNAFRLTAF
DRVKVVILGQDPYHGVGQAHGLAFSVRQGVRIPPSLLNIYKELETDIEGF
SIPAHGCLTAWAEQGILLLNTVLTVRAGQAHSHALLGWERFTDTVIRQLA
THRKHLVFMLWGGYAQQKGRLIDSQNHLILTAPHPSPLSAYRGFFGCRHF
SQANSYLSQHGIEPINWKL

Gene Nucleotide Sequence:  Sequence Viewer
ATGGACACTTGGCACGATGCACTCGGCGGCGAAAAACAGCAGCCGTATTT
TCAGGAAATTTTAAATGCGGTCAGGCAGGAACGTTTGTCGGGGCAAATTA
TCTATCCGCCGGAGGCCGATGTGTTCAACGCATTCCGGCTGACAGCGTTC
GACCGGGTCAAAGTCGTCATTCTCGGACAAGATCCGTATCACGGGGTAGG
GCAGGCGCACGGTTTGGCATTTTCCGTCCGGCAGGGTGTCCGCATACCGC
CGTCTTTACTCAATATTTACAAAGAATTGGAAACCGACATCGAAGGCTTT
TCCATTCCCGCGCACGGCTGCCTGACAGCGTGGGCGGAGCAGGGCATATT
GCTTCTGAACACGGTTTTGACGGTGCGTGCAGGACAGGCGCATTCGCACG
CCCTTTTAGGCTGGGAACGCTTTACCGATACCGTCATCAGGCAGCTTGCG
ACACACCGCAAGCACCTTGTCTTCATGTTGTGGGGTGGGTATGCACAACA
AAAAGGGAGGCTGATAGACAGTCAAAATCATTTGATACTGACCGCGCCTC
ATCCGTCTCCTCTGTCGGCATATCGCGGTTTTTTTGGCTGCCGCCATTTT
TCACAGGCAAACAGCTATTTGAGTCAACACGGTATCGAACCGATAAACTG
GAAGCTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy