Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0644 IGR0649 IGR0646 IGR0645 IGR0647 IGR0648 IGR0644.1 NG0772 NG0776 dhoM,hdh, - NG0779 dbhB, - NG0777 NG0780 NG0774 pivNG, - NG0773 recD, - NG0771 yheS, - NG0781 la,lon, - NG0775 NG0772 NG0776 dhoM,hdh, - NG0779 dbhB, - NG0777 NG0780 NG0774 pivNG, - NG0773 recD, - NG0771 yheS, - NG0781 la,lon, - NG0775 Type: inverse, Name:  - 161 Type: direct, Name:  - 126 Type: inverse, Name:  - 144 Type: inverse, Name:  - 151 Type: inverse, Name:  - 170 NG0772 NG0776 dhoM,hdh, - NG0779 NG0778 NG0778 dbhB, - NG0777 NG0780 NG0774 pivNG, - NG0773 recD, - NG0771 yheS, - NG0781 la,lon, - NG0775
* Calculated from Protein Sequence

Gene ID: NG0775

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
la  lon  

Definition:
ATP-dependent protease La (Lon protease)

Gene Start:
769560

Gene Stop:
772019

Gene Length:
2460

Molecular Weight*:
90778

pI*:
7.20

Net Charge*:
1.55

EC:
3.4.21.53  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Secondary Evidence:
Thomas,C.D., Modha,J., Razzaq,T.M., Cullis,P.M. and Rivett,A.J. Controlled high-level expression of the lon gene of Escherichia coli allows overproduction of Lon protease.
Gene 136
(1-2): 237-242 (1993)
[Medline: 94124005].

Fischer,H. and Glockshuber,R.
A point mutation within the ATP-binding site inactivates both catalytic functions of the ATP-dependent protease La (Lon) fromEscherichia coli.
FEBS Lett. 356 (1): 101-103 (1994)
[Medline: 95080406].

Comment:
From GenBANK (gi:547866): Lon degrades short-lived regulatory and abnormal proteins in presence of ATP, and degrades the regulatory proteins RcsA and SulA. It hydrolyzes two ATPs for each peptide bond cleaved in the protein substrate. It performs hydrolysis of large proteins such as globin, casein and denaturated serum albumin, in presence of ATP. It also contains an allosteric site (distinct from its active site), whose occupancy by an unfolded polypeptide leads to enzyme activation. This cytoplasmic homotetramer is induced by accumulation of abnormal proteins, such as at high temperatures. Both its proteolytic and protein-activated ATPase activities are stimulated by DNA, especially single-stranded DNA. Lon belongs to peptidase family s16, also known as the lon family of atp-dependent proteases.

Oklahoma ID: NGO.775

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ATP-dependent protease; e.g. residues 14-820 are 64% similar to 11350562 of Pseudomonas aeruginosa.

NG0775 is orthologous to AE002471, N. meningitidis MC58 ATP-dependent protease La: residues 1-820 have 97% similarity to residues 1-820 in NG0775.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0466
COG name: ATP-dependent Lon protease, bacterial type
Functional Class:  O
The phylogenetic pattern of COG0466 is ----yqv-eb-hujgpOlinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003111 (ATP-dependent protease La (LON) domain) with a combined E-value of 1.7e-271.
    IPB003111A    212-246
    IPB003111B    277-306
    IPB003111C    315-360
    IPB003111D    389-427
    IPB003111E    428-476
    IPB003111F    526-559
    IPB003111G    613-631
    IPB003111H    637-663
    IPB003111I    681-700
    IPB003111J    701-747
***** IPB001984 (ATP-dependent serine proteases, Lon family) with a combined E-value of 2.6e-162.
    IPB001984A    26-35
    IPB001984B    164-197
    IPB001984C    352-388
    IPB001984D    436-476
    IPB001984E    534-557
    IPB001984F    613-631
    IPB001984G    637-663
    IPB001984H    681-707


ProDom Summary:  Protein Domain Search
Residues 603-645 are 72% similar to a (PROTEASE HYDROLASE SERINE ATP-BINDING ATP-DEPENDENT LA) protein domain (PD001904) which is seen in LON_ERWAM.

Residues 120-241 are 57% similar to a (PROTEASE HYDROLASE SERINE ATP-BINDING ATP-DEPENDENT LA) protein domain (PD002364) which is seen in LON_AZOBR.

Residues 644-788 are 68% similar to a (PROTEASE ATP-BINDING HYDROLASE SERINE PROTEIN) protein domain (PD001169) which is seen in LON_VIBPA.

Residues 121-243 are 48% similar to a (PROTEIN COILED COIL REPEAT FILAMENT HEPTAD PATTERN CHAIN) protein domain (PD000002) which is seen in LON1_MYXXA.

Residues 10-113 are 57% similar to a (PROTEASE ATP-DEPENDENT LA HYDROLASE) protein domain (PD003709) which is seen in LON_ECOLI.

Residues 294-562 are 75% similar to a (PROTEIN ATP-BINDING PROTEASE SUBUNIT REGULATORY HOMOLOG) protein domain (PD000092) which is seen in LON_HAEIN.



Paralogs:  Local Blast Search


NG0775 is paralogously related to NG0367 (DNA repair protein) (8e-09), NG0408 (ATP-dependent Clp protease, ATP-binding subunit ClpA) (3e-04), NG0382 (cell division protein (HflB/FtsH protease) (ATP-dependent zinc metallopeptidase)) (4e-04) and NG0760 (Holliday junction DNA helicase RuvB) (7e-04).


Pfam Summary:  Pfam Search
Residues 13 to 206 (E-value = 2.2e-40) place NG0775 in the LON family which is described as ATP-dependent protease La (LON) domain (PF02190)
Residues 354 to 548 (E-value = 1.7e-43) place NG0775 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)
Residues 586 to 790 (E-value = 1.5e-147) place NG0775 in the Lon_C family which is described as Lon protease (S16) C-terminal proteolytic domain (PF05362)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
140
coil-coil  
194  
281
coil-coil  
544  
581
non-globular  
677  
820

PDB Hit:
pdb|1KSF|1KSF-X CRYSTAL STRUCTURE OF CLPA, AN HSP100 CHAPERONE 44.5 7e-05
pdb|1LV7|1LV7-A CRYSTAL STRUCTURE OF THE AAA DOMAIN OF FTSH 41.0 8e-04
pdb|1KSF|1KSF-X CRYSTAL STRUCTURE OF CLPA, AN HSP100 CHAPERONE 163.0 9e-41
pdb|1IY2|1IY2-A CRYS

Gene Protein Sequence:
MTQKEKHFEEYAALATLPLRDVVVYPHMVLPLFVGRPKSIAALENAITRE
EPVFLLAQTDAAVEEPVATDLYQTGTVAQVLQVLKLPDGTVKVLVEGLYR
GRVLTIEDTGGLFVSHIEAVVEEDTGGNTDLEAVRRTLLAQFEQYAKLNK
KIPAEIIGSINGIAENSRLTDTVAAHLQLKLAQRQQILEIPEIGKRMEFL
LAKLESELDIMQAEKRIRGRVKRQMEKSQREYYLNEQIKAIHKELGEEDE
NGELDALEAGIKKAGMTKEAEEKCLSELKKLKMMPPMSAESTVVRNYIDT
LLGLPWKKKSRVSKDIAKAGLVLDADHYGLEKVKERILEYLAVQKRMDKL
KGPILCLVGPPGVGKTSLGESIAKATGRKYVRMALGGVRDESEIRGHRRT
YIGSMPGKILQNMAKAGVRNPLFLLDEIDKLGSDFRGDPASALLEVLDHE
QNNKFADHYAEVDYDLSDVMFIATSNSLNIPTPLLDRMEIIRLSGYTEDE
KINIAMQYLVPKQMKRNGVKEGELVVEESAVRDIIRYYTREAGVRSLDRE
IAKICRKVVMQITLNEDKKRLSETKKTSKAKPRAVKVNEKNLHDYLGVRR
FDYGVAESENRIGQVTGLAWTEVGGELLTVEAAALPGKGMIQCTGQLGDV
MKESVSAAWSVVRSRAESVGLAPDFYEKKDIHVHVPEGATPKDGPSAGIA
MTLAMVSAFTKIPVRADVAMTGEITLRGEVLPIGGLKEKLLAALRGGIKH
VLIPKDNVKDLEEIPENVKTGLTIHPVKWIDEVLALGLESRPESWAEPSA
AEAAAESASKPKPRSRAIKH

Gene Nucleotide Sequence:  Sequence Viewer
ATGACACAAAAAGAAAAGCATTTTGAGGAATATGCTGCTTTGGCGACCCT
TCCTTTACGGGATGTCGTCGTTTACCCGCATATGGTTCTGCCGCTGTTCG
TCGGCAGGCCGAAATCCATCGCCGCACTGGAAAACGCCATTACCCGCGAG
GAACCGGTTTTCCTGTTGGCGCAAACCGATGCGGCGGTAGAAGAACCGGT
TGCCACCGACCTGTATCAGACCGGTACCGTCGCACAAGTCCTGCAAGTGT
TGAAACTGCCCGACGGCACGGTAAAAGTGCTGGTCGAAGGGCTGTATCGC
GGACGTGTTTTGACCATCGAAGACACGGGCGGGCTGTTCGTTTCTCATAT
AGAGGCGGTCGTGGAAGAAGACACGGGCGGCAATACCGACCTCGAAGCCG
TGCGCCGCACCCTGTTGGCGCAGTTTGAACAATACGCCAAACTCAATAAA
AAAATCCCTGCCGAAATTATCGGCAGCATCAACGGCATTGCCGAAAACAG
CCGGCTAACCGATACGGTCGCAGCGCATTTGCAGTTGAAACTGGCGCAAC
GCCAACAGATTTTGGAGATTCCCGAAATCGGCAAACGGATGGAATTCCTG
CTGGCAAAGCTGGAATCCGAACTCGACATTATGCAGGCCGAAAAACGCAT
ACGCGGACGCGTCAAACGCCAAATGGAAAAATCCCAACGCGAATATTATC
TGAACGAACAGATTAAAGCGATACACAAAGAATTGGGCGAAGAAGACGAA
AACGGCGAACTGGATGCCTTGGAGGCAGGCATCAAAAAGGCGGGTATGAC
CAAAGAAGCGGAAGAAAAATGCCTGTCCGAACTGAAAAAACTCAAAATGA
TGCCGCCGATGTCTGCCGAATCCACCGTCGTACGCAACTACATCGACACC
CTGCTCGGACTGCCGTGGAAGAAAAAATCCCGCGTCAGCAAAGACATCGC
CAAAGCCGGACTGGTGCTGGATGCCGACCACTACGGCCTGGAAAAAGTCA
AAGAACGGATTTTGGAATACCTCGCCGTCCAAAAACGTATGGACAAGCTC
AAAGGTCCGATTCTGTGTTTGGTCGGCCCTCCGGGCGTGGGCAAAACCTC
TTTGGGCGAATCCATCGCCAAAGCAACGGGGCGGAAATATGTCCGTATGG
CCTTGGGCGGCGTGCGCGACGAAAGCGAAATCCGCGGGCACCGCCGTACC
TATATCGGCTCTATGCCCGGCAAGATTTTGCAGAATATGGCAAAAGCAGG
CGTAAGAAACCCGTTGTTCCTGCTCGACGAAATCGACAAATTGGGCAGCG
ACTTTCGGGGCGATCCCGCCAGCGCGTTGCTTGAAGTGCTCGATCACGAA
CAAAACAACAAGTTCGCCGATCATTATGCCGAAGTGGATTACGATTTGAG
CGACGTGATGTTTATTGCGACTTCAAACAGCCTGAATATCCCGACCCCGC
TGCTTGACCGTATGGAAATCATCCGTCTGTCCGGCTATACCGAAGACGAG
AAAATCAATATCGCGATGCAGTATCTCGTACCGAAGCAAATGAAACGCAA
CGGCGTGAAAGAAGGCGAATTGGTGGTCGAAGAAAGCGCGGTACGCGATA
TTATCCGTTATTACACCCGAGAGGCGGGCGTGCGTTCGCTCGACCGCGAA
ATTGCCAAAATCTGCCGTAAGGTGGTGATGCAGATTACCTTGAACGAAGA
TAAGAAGAGGTTGTCTGAAACCAAGAAAACCAGCAAAGCCAAGCCTAGGG
CGGTTAAAGTCAATGAGAAAAACCTACATGACTACTTGGGCGTGCGCCGC
TTCGATTACGGCGTTGCCGAAAGTGAAAACCGCATCGGACAGGTTACCGG
TTTGGCTTGGACGGAAGTCGGCGGCGAATTGCTGACTGTCGAAGCCGCAG
CATTACCGGGTAAAGGCATGATCCAGTGTACCGGCCAGTTGGGCGATGTG
ATGAAGGAATCTGTATCCGCTGCATGGTCTGTTGTCCGTTCCCGTGCGGA
ATCAGTAGGTTTGGCTCCTGATTTTTACGAGAAAAAAGACATTCATGTCC
ATGTTCCCGAAGGTGCAACGCCGAAAGACGGTCCGAGCGCAGGCATTGCT
ATGACTTTGGCGATGGTGTCCGCCTTTACCAAAATTCCGGTGCGTGCCGA
TGTTGCCATGACGGGCGAAATTACCCTGCGCGGCGAAGTCCTGCCGATCG
GCGGTCTGAAGGAAAAACTGTTGGCTGCGCTTCGCGGCGGCATCAAACAC
GTCCTGATTCCGAAAGACAATGTCAAAGACCTGGAAGAAATCCCTGAAAA
CGTGAAAACCGGATTAACCATCCATCCGGTCAAATGGATAGACGAGGTAT
TGGCTTTGGGTTTGGAAAGCCGGCCTGAGTCTTGGGCAGAACCTTCTGCC
GCGGAAGCGGCGGCGGAATCCGCTTCAAAACCGAAACCCCGCAGCAGGGC
AATCAAACAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy