Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0633 IGR0629 IGR0630 IGR0635 IGR0637 IGR0634 IGR0632 IGR0628 IGR0631 IGR0627 IGR0636 NG0759 NG0761 NG0757 ruvB, - NG0760 cca, - NG0763 yjjK,yahG,ybiT, - NG0764 narX, - NG0753 NG0762 mobA, - NG0754 risA, - NG0755 rpeC, - NG0758 NG0756 NG0759 NG0761 NG0757 ruvB, - NG0760 cca, - NG0763 yjjK,yahG,ybiT, - NG0764 narX, - NG0753 NG0762 mobA, - NG0754 risA, - NG0755 rpeC, - NG0758 NG0756 NG0759 NG0761 NG0757 ruvB, - NG0760 cca, - NG0763 yjjK,yahG,ybiT, - NG0764 narX, - NG0753 NG0762 mobA, - NG0754 risA, - NG0755 rpeC, - NG0758 NG0756
* Calculated from Protein Sequence

Gene ID: NG0758

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpeC  

Definition:
ribulose-phosphate 3-epimerase (pentose-5-phosphate 3-epimerase)

Gene Start:
754217

Gene Stop:
754906

Gene Length:
690

Molecular Weight*:
24745

pI*:
6.00

Net Charge*:
-3.65

EC:
5.1.3.1  

Functional Class:
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Carbon fixation
Pentose and glucuronate interconversions
Pentose phosphate cycle

Secondary Evidence:
Kusian,B., Yoo,J.G., Bednarski,R. and Bowien,B. The Calvin cycle enzyme pentose-5-phosphate 3-epimerase is encoded within the cfx operons of the chemoautotroph Alcaligenes eutrophus. J. Bacteriol. 174 (22): 7337-7344 (1992) [Medline: 93054349].

Comment:
From GenBANK (gi:729235): This enzyme catalyzes the reaction: D-ribulose 5-phosphate = D-xylulose 5-phosphate of the calvin cycle. It belongs to the ribulose-phosphate 3-epimerase family.

Oklahoma ID: NGO.758

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ribulose-phosphate 3-epimerases; e.g. residues 3-226 are 68% similar to 729235 of Ralstonia eutropha.

NG0758 is orthologous to AE002472,N. meningitidis MC58 ribulose-phosphate 3-epimerase: residues 1-227 have 95% similarity to residues 1-227 in NG0758.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0036
COG name: Pentose-5-phosphate-3-epimerase
Functional Class:  G
The phylogenetic pattern of COG0036 is -m--yqvcEbrhujgp-lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000056 (Ribulose-phosphate 3-epimerase) with a combined E-value of 1.6e-105.
    IPB000056A    6-38
    IPB000056B    63-91
    IPB000056C    105-157
    IPB000056D    177-206


ProDom Summary:  Protein Domain Search
Residues 6-158 are 74% similar to a (3-EPIMERASE ISOMERASE CARBOHYDRATE) protein domain (PD003683) which is seen in RPEC_ALCEU.

Residues 159-212 are 64% similar to a (3-EPIMERASE RIBULOSE-PHOSPHATE ISOMERASE) protein domain (PD186213) which is seen in RPE_SERMA.



Paralogs:  Local Blast Search


NG0758 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 5 to 209 (E-value = 2.7e-132) place NG0758 in the Ribul_P_3_epim family which is described as Ribulose-phosphate 3 epimerase family (PF00834)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
160  
230

PDB Hit:
pdb|1RPX|1RPX-A D-RIBULOSE-5-PHOSPHATE 3-EPIMERASE FROM SOLANUM 205.0 6e-54
pdb|1H1Y|1H1Y-A THE STRUCTURE OF THE CYTOSOLIC 169.0 5e-43
pdb|1RPX|1RPX-A D-RIBULOSE-5-PHOSPHATE 3-EPIMERASE FROM SOLANUM 308.0 8e-85
pdb|1H1Y|1H1Y-A THE

Gene Protein Sequence:
MTAYRIAPSILSADFARLGEEVANVIAAGADLIHFDVMDNHYVPNLTFGP
MVCAALKPYASVPIDVHLMVEPVDDLIQSFAKAGASIITFHPEASRHIDR
SLSLIRDMGCQAGLVLNPATPVYVLENVLDRLDMVLLMSVNPGFGGQSFI
PHTLEKIRQVRAMLDRYEGKSGRRIAIEVDGGIKTDNIAAVARAGADTFV
AGSAIFGKPDYKAVIAAMRAELEKAARAEP

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGCCTACCGTATCGCACCCAGTATTTTGTCGGCAGACTTTGCCCG
CCTCGGAGAAGAGGTGGCAAATGTCATTGCGGCGGGTGCGGATCTGATCC
ATTTTGACGTGATGGACAACCATTATGTGCCGAACCTGACCTTCGGACCT
ATGGTCTGCGCGGCGTTGAAGCCTTATGCAAGCGTGCCGATCGATGTGCA
TCTGATGGTCGAACCCGTTGACGATTTAATTCAATCGTTTGCCAAAGCAG
GAGCATCGATTATCACTTTCCATCCCGAAGCGAGCCGCCATATCGACCGC
AGCTTGAGCCTGATTCGGGACATGGGCTGTCAGGCGGGGCTGGTGTTGAA
TCCGGCAACGCCCGTATATGTGTTGGAAAACGTGTTAGACAGGCTGGATA
TGGTTTTGCTGATGTCGGTCAACCCCGGGTTCGGCGGTCAGAGCTTCATT
CCGCACACTTTGGAAAAAATCAGACAGGTTCGCGCCATGCTTGACCGCTA
TGAAGGGAAAAGCGGCAGACGTATTGCCATTGAAGTGGACGGCGGCATCA
AAACTGACAATATTGCCGCCGTTGCCCGAGCCGGTGCGGATACCTTTGTT
GCCGGTTCGGCGATTTTCGGCAAACCGGATTACAAGGCGGTAATCGCTGC
GATGAGGGCGGAACTGGAAAAAGCGGCCAGGGCTGAACCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy