Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0633 IGR0629 IGR0630 IGR0635 IGR0634 IGR0632 IGR0628 IGR0631 IGR0626 IGR0625.2 IGR0627 IGR0636 NG0759 NG0761 NG0757 narL,luxR, - NG0752 ruvB, - NG0760 cca, - NG0763 narX, - NG0753 NG0762 NG0750 mobA, - NG0754 risA, - NG0755 rpeC, - NG0758 NG0756 NG0751 NG0759 NG0761 NG0757 narL,luxR, - NG0752 ruvB, - NG0760 cca, - NG0763 narX, - NG0753 NG0762 NG0750 mobA, - NG0754 risA, - NG0755 rpeC, - NG0758 NG0756 NG0751 Type: inverse, Name:  - 155 NG0759 NG0761 NG0757 narL,luxR, - NG0752 ruvB, - NG0760 cca, - NG0763 narX, - NG0753 NG0762 mobA, - NG0754 risA, - NG0755 rpeC, - NG0758 NG0756 NG0751 NG0750
* Calculated from Protein Sequence

Gene ID: NG0755

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
risA  

Definition:
riboflavin synthase alpha subunit

Gene Start:
752091

Gene Stop:
752750

Gene Length:
660

Molecular Weight*:
24254

pI*:
5.70

Net Charge*:
-4.74

EC:
2.5.1.9  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Riboflavin  

Pathway: pathway table
Riboflavin metabolism

Secondary Evidence:
Richter,G., Fischer,M., Krieger,C., Eberhardt,S., Luttgen,H.,
Gerstenschlager,I. and Bacher,A.
Biosynthesis of riboflavin: characterization of the bifunctional
deaminase-reductase of Escherichia coli and Bacillus subtilis
J. Bacteriol. 179 (6), 2022-2028 (1997)
M:97221604

Liao D, Wawrzak Z, Calabrese JC, Viitanen PV, Jordan DB.
Crystal Structure of Riboflavin Synthase.
Structure. 2001 May;9(5):399-408.
PMID: 11377200

Comment:
Oklahoma ID: NGO.755

For the beta chain, see NG0257. For other riboflavin synthesis proteins, see NG0068, NG0089, NG0704.

Blast Summary:  PSI-Blast Search
NG0755 is orthologous to AL162755,N. meningitidis Z2491 putative riboflavin synthase alpha subunit : residues 1-220 have 97% similarity to residues 1-220 in NG0755.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0307
COG name: Riboflavin synthase alpha chain
Functional Class:  H
The phylogenetic pattern of COG0307 is ----yqvcebrhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001783 (Riboflavin synthase alpha chain family lumazine binding domain) with a combined E-value of 3.9e-69.
    IPB001783A    16-27
    IPB001783B    55-67
    IPB001783C    82-125
    IPB001783D    152-164
    IPB001783E    172-200
    IPB001783E    75-103


ProDom Summary:  Protein Domain Search
Residues 42-200 are 62% similar to a (RIBOFLAVIN SYNTHASE ALPHA FLAVOPROTEIN) protein domain (PD004110) which is seen in RISA_ECOLI.



Paralogs:  Local Blast Search


NG0755 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 18 to 103 (E-value = 1.2e-28) place NG0755 in the Lum_binding family which is described as Lumazine binding domain (PF00677)
Residues 116 to 200 (E-value = 6.9e-31) place NG0755 in the Lum_binding family which is described as Lumazine binding domain (PF00677)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1I8D|1I8D-A CRYSTAL STRUCTURE OF RIBOFLAVIN SYNTHASE 249.0 5e-67
pdb|1HZE|1HZE-A SOLUTION STRUCTURE OF THE N-TERMINAL DOMAIN OF 128.0 1e-30
pdb|1KZL|1KZL-A RIBOFLAVIN SYNTHASE FROM S.POMBE BOUND TO 120.0 3e-28
pdb|1I8D|1I8D-A CRYS

Gene Protein Sequence:
MLQFAPFLPTQGNRIMFTGIVQGLGKLTAIHRPSEAFQTYVVELPQEAAE
NLQHGASVANNGCCLTITEIEGNRVSFDLMAETLAKTNLGLLKEGDCVNI
ERAARFGDEIGGHVMSGHIMATVPIVEIERDGFNRTVWFALPHELKPYIL
TKGFVGLDGCSLTIGKVEDSRFNVHLIPETLERTLFGSRKAGDRINIEID
PNTQAIVDTVERLMAQRYAK

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTACAATTTGCACCATTTTTACCGACACAGGGAAACAGGATTATGTT
TACAGGCATTGTTCAAGGATTGGGAAAACTGACGGCAATCCACCGCCCGT
CGGAGGCGTTTCAGACTTATGTCGTCGAGCTTCCGCAAGAGGCGGCAGAA
AACCTGCAACACGGCGCATCGGTCGCCAATAACGGCTGCTGCCTGACGAT
TACTGAAATCGAAGGAAACCGCGTCAGCTTCGATTTAATGGCAGAAACTT
TGGCAAAAACCAATTTGGGGCTGCTGAAGGAAGGCGATTGCGTCAACATC
GAACGGGCGGCACGTTTCGGCGACGAAATCGGCGGACACGTCATGAGCGG
ACACATTATGGCAACCGTGCCCATTGTCGAAATCGAACGGGACGGGTTCA
ACCGCACGGTTTGGTTTGCGCTCCCGCACGAACTCAAACCCTATATCCTG
ACCAAAGGGTTCGTCGGCTTGGACGGTTGCAGCCTGACCATAGGCAAAGT
CGAAGACAGCCGTTTCAATGTCCATCTGATTCCCGAAACTTTGGAACGGA
CGCTGTTCGGCAGCAGAAAGGCCGGAGACAGGATCAACATCGAAATCGAT
CCGAATACGCAGGCAATCGTCGACACCGTCGAACGGCTGATGGCGCAAAG
ATATGCAAAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy