Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0616 IGR0607 IGR0610 IGR0611 IGR0609 IGR0615 IGR0608 IGR0613 IGR0612.1 IGR0612 IGR0614 IGR0606.1 NG0729 NG0732 NG0731 NG0736 NG0727 tpn, - NG0730 aroD, - NG0740 fnr,fenR, - NG0734 NG0728 NG0733 rep, - NG0739 NG0735 dinP, - NG0738 NG0729 NG0732 NG0731 NG0736 NG0727 tpn, - NG0730 aroD, - NG0740 fnr,fenR, - NG0734 NG0728 NG0733 rep, - NG0739 NG0735 dinP, - NG0738 NG0729 NG0731 NG0736 NG0727 tpn, - NG0730 aroD, - NG0740 fnr,fenR, - NG0734 NG0728 NG0733 rep, - NG0739 NG0732 NG0735 dinP, - NG0738
* Calculated from Protein Sequence

Gene ID: NG0734

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fnr  fenR  

Definition:
ferredoxin-NADP reductase, FenR

Gene Start:
732154

Gene Stop:
731378

Gene Length:
777

Molecular Weight*:
29202

pI*:
6.90

Net Charge*:
-0.40

EC:
1.18.1.2  

Functional Class:
Energy metabolism; Electron transport  

Pathway: pathway table
Porphyrin and chlorophyll metabolism

Secondary Evidence:
Bianchi,V., Reichard,P., Eliasson,R., Pontis,E., Krook,M.,Jornvall,H. and Haggard-Ljungquist,E. Escherichia coli ferredoxin NADP+ reductase: activation of E. coli anaerobic ribonucleotide reduction, cloning of the gene (fpr), and overexpression of the protein. J. Bacteriol. 175 (6): 1590-1595 (1993) [Medline: 93194782].

Jenkins,C.M. and Waterman,M.R. Flavodoxin and NADPH-flavodoxin reductase from Escherichia coli support bovine cytochrome P450c17 hydroxylase activities. J. Biol. Chem. 269 (44): 27401-27408 (1994) [Medline: 95050480].

Comment:
From GenBANK (gi:11386823): FenR transports electrons between flavodoxin or ferredoxin and NADPH by the reaction: reduced ferredoxin + NADP(+) = oxidized ferredoxin + NADPH, requiring a cofactor, FAD.

Oklahoma ID: NGO.734c

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ; e.g. residues 1-257 are 42% similar to 11351616 of Pseudomonas aeruginosa.

NG0734 is orthologous to AE002495, N. meningitidis MC58 ferredoxin--NADP reductase: residues 1-259 have 97% similarity to residues 1-259 in NG0734.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1018
COG name: Flavodoxin reductases (ferredoxin-NADPH reductases) family 1
Functional Class:  C
The phylogenetic pattern of COG1018 is ----y---EbR----------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** PR00371 (Flavoprotein pyridine nucleotide cytochrome reductase signature) with a combined E-value of 1.1e-07.
    PR00371B    56-63
    PR00371D    116-135
    PR00371H    220-228
***** IPB001433 (Oxidoreductase FAD and NAD(P)-binding domain) with a combined E-value of 2.2e-07.
    IPB001433A    117-126
    IPB001433B    220-231
***** PR00410 (Phenol hydroxylase reductase family signature) with a combined E-value of 1.7e-06.
    PR00410A    37-49
    PR00410B    56-63
    PR00410D    116-135


ProDom Summary:  Protein Domain Search
Residues 56-126 are 40% similar to a (REDUCTASE OXIDOREDUCTASE FAD FLAVOPROTEIN NADP HEME NAD) protein domain (PD000183) which is seen in Q9Z673_ZYMMO.

Residues 127-257 are 33% similar to a (REDUCTASE FERREDOXIN--NADP FNR PROTEIN OXIDOREDUCTASE) protein domain (PD109340) which is seen in Q9Z615_BUCAP.



Paralogs:  Local Blast Search


NG0734 is paralogously related to NG0687 (ferredoxin-NADP reductase) (2e-39).


Pfam Summary:  Pfam Search
Residues 112 to 236 (E-value = 1.4e-06) place NG0734 in the NAD_binding_1 family which is described as Oxidoreductase NAD-binding domain (PF00175)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
115  
131

PDB Hit:
pdb|1A8P|1A8P FERREDOXIN REDUCTASE FROM AZOTOBACTER VINELANDII 134.0 2e-32
pdb|1FDR|1FDR FLAVODOXIN REDUCTASE FROM E. COLI 118.0 8e-28
pdb|1A8P|1A8P FERREDOXIN REDUCTASE FROM AZOTOBACTER VINELANDII 347.0 1e-96
pdb|1KRH|1KRH-A X-RA

Gene Protein Sequence:
MAASPEAKFTEEKILWVKHHTPKLITFAISRPESYRFKAGQFSRLGFYEG
KGFIWRAYSVVSAEYADTLEYFAVLIQDGPMSALFAKMQQGDTILLDKNA
TGFLLPERFPDGKDLVMLCTGSGIAPFLSILEQPEIRQRFDTVNLIHSVS
FPEELIFNDRLAALSEHPLVGEYGHSFRFVPVTTRAANPSGLSGKRIPEL
LKNNSIEQALHTKLTPESTRFMICGNPEMVKDTFQTLLDMGYAMHRNRIP
GQIMMENGF

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGCCTCGCCCGAAGCAAAATTCACCGAAGAAAAGATTTTGTGGGT
CAAACACCACACGCCGAAACTCATCACTTTCGCCATCAGCCGTCCCGAAT
CCTACCGTTTTAAAGCCGGACAGTTCTCCCGACTCGGTTTCTACGAAGGT
AAAGGCTTTATTTGGCGTGCCTATTCCGTCGTTTCCGCAGAATATGCCGA
CACGCTCGAATATTTTGCCGTACTCATCCAAGACGGCCCCATGTCGGCCC
TTTTCGCCAAAATGCAACAGGGCGACACCATCCTGCTCGATAAAAATGCC
ACTGGCTTTCTCCTGCCCGAACGCTTCCCCGACGGCAAGGATTTGGTGAT
GCTCTGTACCGGCTCGGGCATCGCCCCCTTCCTTTCCATTCTCGAACAAC
CCGAAATCCGGCAGCGTTTCGATACCGTCAACCTGATACATTCCGTATCT
TTTCCCGAAGAATTGATTTTCAACGACCGGCTGGCCGCATTGTCCGAACA
TCCCCTGGTAGGCGAATACGGACACTCGTTCCGTTTCGTCCCTGTTACCA
CCCGTGCCGCCAACCCCTCGGGCTTAAGCGGAAAACGCATTCCGGAACTC
TTAAAAAACAACAGCATCGAACAGGCGCTGCATACCAAGCTCACCCCGGA
ATCCACACGGTTTATGATTTGCGGTAACCCGGAAATGGTCAAAGACACTT
TCCAAACGCTGCTCGATATGGGTTACGCCATGCACCGCAACCGCATTCCC
GGTCAAATCATGATGGAAAACGGCTTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy