Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0603 IGR0602 IGR0604 IGR0600 IGR0606 IGR0599 IGR0601 IGR0605 IGR0606.1 NG0725 NG0726 NG0722 NG0720 NG0723 hexR, - NG0718 hxkG, - NG0717 NG0721 g6pD, - NG0715 g6pi, - NG0719 NG0725 NG0726 NG0722 NG0720 NG0723 hexR, - NG0718 hxkG, - NG0717 NG0721 g6pD, - NG0715 g6pi, - NG0719 Type: tandem, Name:  - 34 NG0725 NG0726 NG0720 hexR, - NG0718 hxkG, - NG0717 NG0721 g6pD, - NG0715 g6pi, - NG0719 NG0724 6pgl, - NG0716 6pgl, - NG0716 NG0723 NG0722 NG0724
* Calculated from Protein Sequence

Gene ID: NG0719

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
g6pi  

Definition:
glucose-6-phosphate isomerase

Gene Start:
719593

Gene Stop:
721236

Gene Length:
1644

Molecular Weight*:
62108

pI*:
6.50

Net Charge*:
-7.79

EC:
5.3.1.9  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  

Pathway: pathway table
Glycolysis / Gluconeogenesis
Pentose phosphate cycle
Starch and sucrose metabolism

Secondary Evidence:
Froman,B.E., Tait,R.C. and Gottlieb,L.D. Isolation and characterization of the phosphoglucose isomerase gene from Escherichia coli. Mol. Gen. Genet. 217 (1): 126-131 (1989) [Medline: 89364675].

Smith,M.W. and Doolittle,R.F. Anomalous phylogeny involving the enzyme glucose-6-phosphate isomerase. J. Mol. Evol. 34 (6): 544-545 (1992) [Medline: 92277670].

Comment:
From GenBANK (gi:120738): This protein catalyzes the reaction: glucose 6-phosphate = fructose 6-phosphate, and is involved in glycolysis and in gluconeogenesis.

Oklahoma ID: NGO.719

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to glucose-6-phosphate isomerase; e.g. residues 4-547 are 60% similar to 11386866 of Helicobacter pylori.

NG0719 is orthologous to AE002487, N. meningitidis MC58 glucose-6-phosphate isomerase: residues 1-548 have 96% similarity to residues 1-548 in NG0719.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0166
COG name: Glucose-6-phosphate isomerase
Functional Class:  G
The phylogenetic pattern of COG0166 is -m--yqvcebrhujgpolin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001672 (Phosphoglucose isomerase (PGI)) with a combined E-value of 3e-203.
    IPB001672A    79-99
    IPB001672B    131-167
    IPB001672C    181-223
    IPB001672D    237-272
    IPB001672E    317-363
    IPB001672F    375-393
    IPB001672G    414-437
    IPB001672H    480-512


ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG0719 is paralogously related to NG1668 (glucose-6-phosphate isomerase (Gpi)) (1e-143).


Pfam Summary:  Pfam Search
Residues 49 to 539 (E-value = 2.1e-280) place NG0719 in the PGI family which is described as Phosphoglucose isomerase (PF00342)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1GZD|1GZD-A CRYSTAL STRUCTURE OF PIG PHOSPHOGLUCOSE 611.0 0e+00
pdb|1JLH|1JLH-A HUMAN GLUCOSE-6-PHOSPHATE ISOMERASE 607.0 0e+00
pdb|1IAT|1IAT-A CRYSTAL STRUCTURE OF HUMAN PHOSPHOGLUCOSE 606.0 0e+00
pdb|1IRI|1IRI-A CRYS

Gene Protein Sequence:
MKHLHDLPAWSKLWNHFDDSKTLHMREMFEQDPQRAERYWLQVGGLTLDY
SKNRINDETMSLLFELAREAGVPERMRQMFHGEKINTTENRAVLHVALRN
RTNSPIMVDGEDVMPKVNRVLQRMGEFAHEVRSGSWLGYTNQVITDVVNI
GIGGSDLGPLTMCTALKPFGHPRLNMHFVSNVDGSQLRDVLSKVHPETTL
FIIASKTFTTQETLTNALTAREWFLNHAGDEEAVAKHFAAVSTNRKAVAE
FGIDIANMFEFWDWVGGRYSLWSAIGLPIMLYLGEENFIEMLNGAHLMDQ
HFINTPLERNLPVILALIGIWYINYYGGGSHVIAPYDQHLHRLPKFIQQL
DMESNGKQVTLDGKAVGHETSPIIWGETGINGQHAFFQLLHQGTHITPID
LIASLEKRSNLPGHHEILLANVFAQAEAFMCGKTPDEVRAELKAQGMDEA
RIEELVPHKTFSGNRPTNLILMDKVNPRNMGSLIAMYEHKTFVQGIIWGI
NSFDQWGVELGKQLAKTILGELTGETEPQKHDSSTERLINLYLQTNRK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACACCTTCACGACTTACCGGCCTGGTCAAAATTGTGGAACCACTT
TGACGACAGCAAAACATTGCATATGCGCGAAATGTTCGAGCAAGACCCGC
AGCGGGCGGAACGCTACTGGCTGCAAGTCGGCGGACTGACGCTGGACTAC
TCCAAAAACCGCATCAACGACGAAACCATGTCCCTACTGTTCGAGTTGGC
GCGTGAAGCAGGCGTGCCGGAGCGGATGCGGCAGATGTTCCACGGCGAAA
AAATCAATACCACCGAAAACCGCGCCGTCCTGCATGTCGCCCTTCGCAAC
CGCACCAATTCGCCGATTATGGTTGACGGTGAAGATGTGATGCCCAAAGT
CAACCGCGTTTTGCAACGTATGGGCGAATTTGCACACGAAGTCCGCAGCG
GAAGCTGGCTGGGCTATACCAACCAAGTCATTACCGACGTTGTCAACATC
GGCATCGGCGGATCGGATTTGGGCCCGCTGACGATGTGTACCGCGCTCAA
ACCTTTCGGTCATCCGCGCCTCAATATGCACTTCGTCTCCAACGTGGACG
GCTCGCAACTGCGCGACGTATTGTCCAAAGTCCACCCGGAAACCACGCTG
TTCATCATCGCCTCCAAAACATTTACCACGCAGGAAACGCTGACCAACGC
GCTGACCGCGCGCGAATGGTTTTTGAATCATGCGGGTGACGAAGAAGCCG
TTGCCAAACACTTCGCCGCCGTTTCCACCAATCGAAAAGCCGTCGCCGAA
TTCGGCATCGACATCGCCAATATGTTTGAATTTTGGGATTGGGTCGGCGG
TCGGTACAGCCTGTGGTCCGCCATCGGATTGCCGATTATGCTGTATCTCG
GCGAAGAAAACTTCATCGAAATGCTCAACGGCGCGCACCTGATGGACCAA
CACTTCATCAACACCCCGCTCGAGCGCAACCTGCCCGTCATCCTCGCCCT
CATCGGCATCTGGTATATCAACTACTACGGTGGCGGCAGCCACGTCATCG
CGCCTTACGACCAACATTTGCACCGCCTGCCCAAATTCATCCAGCAGCTC
GATATGGAAAGCAACGGCAAACAGGTTACGTTGGACGGCAAAGCAGTCGG
ACACGAAACCTCGCCGATTATCTGGGGAGAAACGGGCATTAACGGTCAGC
ACGCCTTCTTCCAACTGCTGCATCAAGGCACGCACATCACCCCCATCGAC
CTGATTGCCTCGCTTGAAAAACGCAGCAACCTGCCCGGACACCACGAAAT
CCTGCTTGCCAACGTCTTTGCACAAGCAGAAGCCTTTATGTGCGGCAAAA
CCCCCGACGAAGTCCGCGCCGAACTCAAAGCGCAGGGTATGGATGAGGCG
CGCATCGAAGAGCTGGTTCCGCACAAAACCTTCTCCGGCAACCGCCCGAC
CAACCTCATCCTGATGGATAAGGTCAACCCCCGCAATATGGGCAGCCTGA
TTGCCATGTACGAACACAAAACCTTCGTCCAAGGCATCATTTGGGGCATC
AACAGCTTCGACCAGTGGGGCGTGGAACTCGGCAAACAACTGGCTAAAAC
CATTTTGGGCGAACTGACAGGCGAAACCGAACCTCAAAAACACGACAGCT
CGACCGAACGCCTGATTAACCTCTACCTGCAGACCAACCGCAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy