Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0603 IGR0602 IGR0604 IGR0600 IGR0599 IGR0601 IGR0605 IGR0598 edd, - NG0714 NG0722 NG0720 NG0723 hexR, - NG0718 hxkG, - NG0717 NG0721 g6pD, - NG0715 g6pi, - NG0719 edd, - NG0714 NG0722 NG0720 NG0723 hexR, - NG0718 hxkG, - NG0717 NG0721 g6pD, - NG0715 g6pi, - NG0719 edd, - NG0714 NG0720 NG0723 hexR, - NG0718 hxkG, - NG0717 NG0721 g6pD, - NG0715 g6pi, - NG0719 6pgl, - NG0716 6pgl, - NG0716 NG0722
* Calculated from Protein Sequence

Gene ID: NG0717

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hxkG  

Definition:
glucokinase

Gene Start:
717484

Gene Stop:
718467

Gene Length:
984

Molecular Weight*:
35099

pI*:
7.40

Net Charge*:
1.64

EC:
2.7.1.2  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Fructose and mannose metabolism
Galactose metabolism
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism

Secondary Evidence:
Meyer,D., Schneider-Fresenius,C., Horlacher,R., Peist,R. andBoos,W.
Molecular characterization of glucokinase from Escherichia coli K-12.
J. Bacteriol. 179 (4): 1298-1306 (1997)
Medline: 9717556.

Comment:
From GenBANK (gi:3183526): This glucokinase is not highly important in E.coli as glucose is transported into the cell by the PTS system already as glucose 6-phosphate by the reaction: ATP + d-glucose = ADP + d-glucose 6-phosphate.

Oklahoma ID: NGO.717

Blast Summary:  PSI-Blast Search
Many significant hits in gapped BLAST to glucokinase; e.g. residues 7-325 are 58% similar to 7449193 of Helicobacter pylori.

NG0717 is orthologous to AL162756, N. meningitidis Z2491 glucokinase: residues 1-328 have 93% similarity to residues 1-328 in NG0717.

COGS Summary:  COGS Search
BeTs to 3 clades of COG0837
COG name: Glucokinase
Functional Class:  G
The phylogenetic pattern of COG0837 is -------ce---uj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003836 (Glucokinase) with a combined E-value of 3.7e-113.
    IPB003836A    17-27
    IPB003836B    69-87
    IPB003836C    98-127
    IPB003836D    140-173
    IPB003836E    192-207
    IPB003836F    226-258
    IPB003836G    275-316
    IPB003836F    242-274


ProDom Summary:  Protein Domain Search
Residues 14-325 are 58% similar to a (GLUCOKINASE GLUCOSE KINASE TRANSFERASE GLYCOLYSIS) protein domain (PD014148) which is seen in Q9ZKB0_BBBBB.



Paralogs:  Local Blast Search


NG0717 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 9 to 324 (E-value = 7.9e-154) place NG0717 in the Glucokinase family which is described as Glucokinase (PF02685)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
244  
260
transmembrane  
299  
315

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MSSTPNKHADYPRLVADIGGTNARFALETAPCVIEKVAVLPCKEYDTVTD
AVRAYLNQSGATGVRHAAFAIANPILGDWVQMTNHHWAFSIETTRQALGL
DTLILLNDFTAQALAVTQTSSKDLMQVGGQKPVEFAPKAVIGPGTGLGVS
GLVHSPAGWVALAGEGGHTSFPPFDDMEVLIWQYAKNKYRHVSAERFLSG
AGLSLIYETLAVKQKAEPAKLMPSEITEKALNCESPLCRQALDIFCAMLG
TVASNLALTLGARGGVYLCGGIIPRMLDYFKTSPFRSRFENKGRFEAYLA
AIPVYVVLSEFPGIAGAAAALGNHLKNV

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTTCTACGCCGAATAAACACGCCGATTACCCGAGGCTGGTTGCCGA
CATCGGCGGCACAAACGCCCGTTTCGCATTGGAAACCGCGCCGTGCGTGA
TTGAGAAAGTCGCCGTCCTGCCGTGTAAGGAATACGACACGGTTACCGAC
GCGGTGCGTGCCTATCTGAACCAAAGTGGTGCAACGGGCGTACGGCACGC
GGCATTTGCCATCGCCAACCCGATTTTGGGCGACTGGGTGCAGATGACCA
ACCACCATTGGGCGTTTTCCATCGAAACCACCCGTCAGGCTTTGGGGCTG
GACACCCTCATCCTTTTGAACGACTTTACCGCGCAGGCATTGGCGGTAAC
GCAGACTTCAAGCAAAGACCTGATGCAGGTAGGCGGGCAAAAGCCTGTCG
AATTCGCCCCCAAGGCCGTTATCGGCCCCGGTACCGGCTTGGGCGTGAGC
GGATTGGTGCACAGCCCCGCAGGCTGGGTGGCGTTGGCGGGCGAGGGCGG
GCATACCAGTTTCCCGCCGTTTGACGATATGGAAGTGTTGATTTGGCAGT
ACGCCAAAAACAAATACCGCCACGTTTCCGCCGAACGTTTCCTCAGCGGC
GCAGGTTTGAGCCTGATTTATGAAACGCTGGCGGTCAAGCAGAAAGCCGA
ACCGGCAAAACTGATGCCGTCTGAAATTACCGAAAAGGCATTAAATTGCG
AATCGCCCCTGTGCCGGCAGGCATTGGACATTTTCTGCGCGATGCTGGGC
ACGGTCGCTTCCAACCTCGCCCTGACTTTGGGCGCGCGCGGGGGCGTGTA
TTTGTGCGGCGGCATTATCCCGCGAATGTTGGATTACTTCAAAACCTCCC
CCTTCCGCAGCCGCTTTGAAAACAAAGGGCGTTTTGAAGCCTACCTTGCC
GCGATTCCCGTTTATGTCGTCTTGAGCGAATTTCCGGGTATTGCCGGCGC
GGCGGCGGCGCTCGGCAACCACCTGAAAAACGTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy