Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0603 IGR0602 IGR0600 IGR0599 IGR0597 IGR0601 IGR0598 eda,alkH, - NG0713 edd, - NG0714 NG0720 hexR, - NG0718 hxkG, - NG0717 NG0721 g6pD, - NG0715 g6pi, - NG0719 eda,alkH, - NG0713 edd, - NG0714 NG0720 hexR, - NG0718 hxkG, - NG0717 NG0721 g6pD, - NG0715 g6pi, - NG0719 eda,alkH, - NG0713 edd, - NG0714 hexR, - NG0718 hxkG, - NG0717 NG0721 g6pD, - NG0715 g6pi, - NG0719 6pgl, - NG0716 6pgl, - NG0716 NG0720
* Calculated from Protein Sequence

Gene ID: NG0716

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
6pgl  

Definition:
6-phosphogluconolactonase

Gene Start:
716808

Gene Stop:
717500

Gene Length:
693

Molecular Weight*:
24863

pI*:
5.00

Net Charge*:
-11.40

EC:
3.1.1.31  

Functional Class:
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Pentose phosphate cycle

Comment:
For other 'pgl'genes see NG0083 (pglD),NG0084 (pglC), NG0085 (pglB), NG0207 (pglE) and NG1765 (pglA).

From GenBANK (gi:7387505): This protein functions in the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate by the reaction: 6-phospho-d-glucono-1,5-lactone + H2O = 6-phospho-d-gluconate. It is involved in the second step in the pentose phosphate pathway and belongs to the glucosamine/galactosamine-6-phosphate isomerase family, 6-phosphogluconolactonase subfamily.

Oklahoma ID: NGO.716

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to 6-phosphogluconolactonase; e.g. residues 9-218 are 42% similar to 7387516 of Pseudomonas aeruginosa.

NG0716 is orthologous to AL162756, N. meningitidis Z2491 6-phosphogluconolactonase: residues 1-231 have 89% similarity to residues 1-231 in NG0716.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0363
COG name: Glucosamine-6-phosphate deaminase (Glucosamine-6-phosphate isomerase)
Functional Class:  G
The phylogenetic pattern of COG0363 is ----Y-vcEBrHuj--Olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000457 (Glucosamine/galactosamine-6-phosphate isomerase) with a combined E-value of 4.7e-14.
    IPB000457A    36-78
    IPB000457B    117-169
    IPB000457C    178-231


ProDom Summary:  Protein Domain Search
Residues 6-127 are 36% similar to a (GLUCOSE-6-PHOSPHATE 1-DEHYDROGENASE DEVB PROTEIN) protein domain (PD095555) which is seen in O25730_HELPY.

Residues 5-70 are 40% similar to a (DEVB OXIDOREDUCTASE PROTEIN HOMOLOG) protein domain (PD016513) which is seen in Q9Z3S1_RHIME.

Residues 131-223 are 42% similar to a (PROTEIN OXIDOREDUCTASE DEVB HOMOLOG) protein domain (PD004927) which is seen in O25730_HELPY.


Paralogs:  Local Blast Search


NG0716 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
31

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MFVWHEYENAAEAAQSLADAVADALQGALDEKGGAVLAVSGGRSPIAFFN
ALSQKDLDWKNVGITLADERIVPTNHADSNTGLVREYLLKNKAAAAVWIP
MVEDGKTETELHPDAVVDYALKHYKQPDVLILGMGNDGHTASIFPKAPQF
QTAIDGSAGVALVHTTPVTAPHERISMTLDAIAHTGHVFLAIQGEEKKAV
FDQAAQGENREYPISLVLNHQGVNCHVFYAE

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTGTTTGGCACGAATACGAAAATGCGGCAGAAGCGGCGCAGTCTTT
GGCTGACGCAGTGGCGGATGCTTTGCAGGGCGCACTGGACGAGAAGGGCG
GTGCGGTGTTGGCAGTTTCCGGCGGACGTTCGCCGATTGCATTTTTCAAC
GCCCTGTCGCAAAAAGATTTGGATTGGAAAAACGTCGGAATTACCTTGGC
AGATGAACGCATCGTGCCGACCAACCACGCCGACAGCAATACCGGTCTGG
TGCGCGAATACCTGTTAAAGAACAAAGCCGCTGCGGCAGTGTGGATTCCT
ATGGTGGAAGACGGAAAAACTGAAACCGAATTACATCCCGATGCTGTTGT
CGATTATGCGCTGAAACATTACAAGCAGCCCGATGTTTTGATTTTGGGTA
TGGGAAACGACGGGCATACGGCTTCGATTTTCCCAAAAGCTCCGCAGTTT
CAGACGGCAATCGACGGTTCGGCAGGTGTCGCGCTGGTGCATACCACGCC
CGTTACCGCGCCGCACGAGCGCATCAGCATGACTTTGGATGCGATTGCCC
ATACTGGGCATGTATTTTTGGCGATACAGGGCGAAGAGAAAAAAGCCGTG
TTCGACCAAGCCGCACAAGGCGAAAACCGCGAATATCCGATCAGCCTCGT
TTTGAACCATCAAGGAGTGAACTGCCATGTCTTCTACGCCGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy