Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0600 IGR0599 IGR0596 IGR0597 IGR0601 IGR0595.1 IGR0598 eda,alkH, - NG0713 edd, - NG0714 NG0712 hexR, - NG0718 hxkG, - NG0717 NG0711 g6pD, - NG0715 g6pi, - NG0719 eda,alkH, - NG0713 edd, - NG0714 NG0712 hexR, - NG0718 hxkG, - NG0717 NG0711 g6pD, - NG0715 g6pi, - NG0719 eda,alkH, - NG0713 edd, - NG0714 hexR, - NG0718 hxkG, - NG0717 NG0711 g6pD, - NG0715 g6pi, - NG0719 6pgl, - NG0716 6pgl, - NG0716 NG0712
* Calculated from Protein Sequence

Gene ID: NG0715

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
g6pD  

Definition:
glucose 6-phosphate 1-dehydrogenase

Gene Start:
715211

Gene Stop:
716653

Gene Length:
1443

Molecular Weight*:
53879

pI*:
5.20

Net Charge*:
-11.92

EC:
1.1.1.49  

Functional Class:
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Glutathione metabolism
Pentose phosphate cycle

Secondary Evidence:
Rowley,D.L. and Wolf,R.E. Jr. Molecular characterization of the Escherichia coli K-12 zwf gene encoding glucose 6-phosphate dehydrogenase. J. Bacteriol. 173 (3): 968-977 (1991) [Medline: 91123224].

Carter,A.T., Pearson,B.M., Dickinson,J.R. and Lancashire,W.E. Sequence of the Escherichia coli K-12 edd and eda genes of the Entner-Doudoroff pathway. Gene 130 (1): 155-156 (1993) [Medline: 93345818].

Comment:
From GenBANK (gi:2506448): Glucose 6-phosphate dehydrogenase catalyzes the reaction: D-glucose 6-phosphate + NADP(+) = d-glucono-delta-lactone 6-phosphate + NADPH. This is the first step in pentose phosphate pathway. G6PD belongs to the
glucose-6-phosphate dehydrogenase family.

Oklahoma ID: NGO.715

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to glucose 6-phosphate 1-dehydrogenase; e.g. residues 2-479 are 48% similar to 11351315 of Pseudomonas aeruginosa.

NG0715 is orthologous to AE002487, N. meningitidis MC58 glucose-6-phosphate 1-dehydrogenase: residues 1-481 have 95% similarity to residues 1-481 in NG0715.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0364
COG name: Glucose-6-phosphate 1-dehydrogenase
Functional Class:  G
The phylogenetic pattern of COG0364 is ----yqvcebRhuj--olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001282 (Glucose-6-phosphate dehydrogenase) with a combined E-value of 5.4e-144.
    IPB001282A    9-26
    IPB001282B    111-123
    IPB001282C    174-201
    IPB001282D    205-251
    IPB001282E    295-348
    IPB001282F    363-385
    IPB001282G    408-443
    IPB001282H    456-466


ProDom Summary:  Protein Domain Search
Residues 10-463 are 47% similar to a (GLUCOSE-6-PHOSPHATE 1-DEHYDROGENASE OXIDOREDUCTASE NADP) protein domain (PD001129) which is seen in G6PD_RHIME.



Paralogs:  Local Blast Search


NG0715 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 185 (E-value = 5.1e-64) place NG0715 in the G6PD_N family which is described as Glucose-6-phosphate dehydrogenase, NAD binding domain (PF00479)
Residues 187 to 480 (E-value = 1.2e-143) place NG0715 in the G6PD_C family which is described as Glucose-6-phosphate dehydrogenase, C-terminal domain (PF02781)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1QKI|1QKI-A X-RAY STRUCTURE OF HUMAN GLUCOSE 6-PHOSPHATE 290.0 3e-79
pdb|1E77|1E77-A COMPLEX OF ACTIVE MUTANT (Q365->C) OF GLUCOSE 285.0 1e-77
pdb|1H93|1H93-A ACTIVE MUTANT (S215->C) OF GLUCOSE 6-PHOSPHATE 284.0 2e-77
pdb|1DPG|1DPG-A GLUC

Gene Protein Sequence:
MSTQTNFDLVLFGATGDLAMRKLLPCLYQAHVAGLLHPEGRILGVSRSEL
DTEGFLAKVETSSKIHVKENFSGEAWASFVERLAYLKVDVTQPDDFAALG
DLVKARKETDNVVIYLSTAPKFFAQACENLAAIGLNADNVRVVLEKPLGT
DLASSQQINTDVARYFKEGQIYRIDHYLGKESLQNLLALRFANVMFEPLW
NNKYIESVQLTIAEQLGVEERGEFYDITGALRDMVQNHLMQMLCMTAMEA
PAGLDADAVRDEKVKVIKSLKPLTIESVNENVVRGQYTAAKGMNGYLEEI
NVPQDSFTETYVAIKAEIENERWKGVPFYLRTGKRMAGKVAEIVLNFRPL
QNHIFDNSQTAPNRLVIELQPNESVRLYTQVKTPGAGNKVEVTPLGVDLG
KAVEGRRAEAYERLLLDVINGKLALFNRRDELEAAWEYVMPILENWANNT
TPPHGYGAHSWGPEAARELLARDGNKWHEEQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTACACAGACAAATTTTGATTTGGTGTTGTTCGGTGCGACCGGCGA
TTTGGCAATGCGCAAACTTTTGCCCTGCCTGTATCAGGCGCATGTTGCCG
GTCTGCTTCATCCCGAAGGGCGTATTTTGGGGGTCAGCCGCAGCGAGTTG
GATACCGAAGGTTTTCTGGCGAAGGTGGAAACCAGTTCCAAAATCCATGT
GAAAGAAAATTTTTCCGGTGAGGCGTGGGCTTCGTTTGTTGAACGTCTCG
CATATCTCAAAGTCGATGTTACGCAGCCGGACGATTTTGCCGCTTTGGGC
GATTTGGTCAAAGCACGCAAAGAAACCGACAACGTCGTCATCTATCTGTC
CACCGCGCCGAAATTCTTCGCGCAAGCCTGCGAAAACCTTGCTGCGATCG
GTTTGAATGCCGACAATGTGCGCGTGGTTTTGGAAAAACCGCTGGGTACG
GATTTGGCTTCTTCCCAACAAATCAATACCGATGTGGCGCGTTATTTCAA
AGAAGGGCAAATTTACCGCATCGACCACTACCTTGGCAAAGAAAGCCTGC
AAAACCTGCTTGCGCTGCGTTTTGCCAATGTAATGTTCGAGCCGCTGTGG
AACAATAAATACATCGAAAGCGTGCAGCTGACCATCGCCGAACAGCTCGG
TGTGGAAGAGCGCGGCGAGTTTTACGACATTACCGGCGCGTTGCGCGATA
TGGTGCAAAACCATTTGATGCAGATGCTGTGCATGACTGCGATGGAAGCC
CCCGCCGGCTTGGATGCCGACGCGGTGCGCGATGAAAAAGTCAAAGTCAT
CAAGTCATTGAAGCCGCTGACCATCGAATCTGTCAATGAAAATGTCGTGC
GCGGACAATATACCGCTGCCAAAGGCATGAACGGCTATCTTGAAGAAATC
AACGTTCCGCAAGACAGCTTTACCGAAACCTACGTCGCCATTAAAGCCGA
AATCGAAAACGAACGCTGGAAGGGCGTTCCCTTCTACCTGCGTACCGGCA
AACGCATGGCGGGCAAAGTGGCGGAAATCGTTTTGAACTTCCGCCCGCTG
CAAAACCATATTTTCGACAACAGCCAAACCGCGCCGAACCGTTTGGTTAT
CGAGCTTCAACCGAATGAATCCGTCCGCCTTTACACGCAGGTGAAAACCC
CGGGTGCGGGCAACAAAGTGGAAGTAACGCCTTTGGGCGTGGATTTGGGC
AAGGCCGTTGAAGGCCGCCGCGCCGAGGCTTACGAACGCCTGCTGTTGGA
TGTGATTAACGGCAAACTCGCTTTGTTCAACCGCCGCGACGAACTCGAAG
CCGCGTGGGAATATGTGATGCCGATTTTGGAAAACTGGGCAAATAACACC
ACGCCGCCGCACGGTTACGGCGCACACTCTTGGGGTCCTGAAGCCGCCCG
CGAACTGTTGGCGCGCGACGGCAACAAGTGGCACGAAGAACAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy