Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0587 IGR0586 IGR0585 IGR0583 IGR0588 IGR0584 IGR0583.1 NG0695 NG0694 NG0698 NG0701 hsdS, - NG0699 NG0696 hsdM, - NG0702 hsdR, - NG0697 NG0695 NG0694 NG0698 NG0701 hsdS, - NG0699 NG0696 hsdM, - NG0702 hsdR, - NG0697 NG0695 NG0694 NG0698 NG0701 hsdS, - NG0699 NG0696 hsdM, - NG0702 hsdR, - NG0697 NG0700 NG0700
* Calculated from Protein Sequence

Gene ID: NG0697

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hsdR  

Definition:
type I restriction enzyme R protein HsdR

Gene Start:
690057

Gene Stop:
693080

Gene Length:
3024

Molecular Weight*:
116203

pI*:
6.40

Net Charge*:
-9.41

EC:
3.1.21.3  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Cowan,G.M., Gann,A.A. and Murray,N.E. Conservation of complex DNA recognition domains between families of restriction enzymes. Cell 56 (1): 103-109 (1989) [Medline: 89089749].
Fuller-Pace,F.V. and Murray,N.E. Two DNA recognition domains of the specificity polypeptides of a family of type I restriction enzymes. Proc. Natl. Acad. Sci. U.S.A. 83 (24): 9368-9372 (1986) [Medline: 87092254].
Price,C., Lingner,J., Bickle,T.A., Firman,K. and Glover,S.W. Basis for changes in DNA recognition by the EcoR124 and EcoR124/3 type I DNA restriction and modification enzymes. J. Mol. Biol. 205 (1): 115-125 (1989) [Medline: 89178628].

Comment:
For other 'hsd' genes, see NG0407 (hsdR), NG0404 (hsdM), NG0699 (hsdS), NG0702 (hsdM).

From GenBANK (gi:12644577): HsdR (subunit r) is required for both nuclease and ATPase activities, but not for modification. The type I restriction & modification system is composed of three polypeptides r,m and s.

From GenBANK (gi:1174557): The m and s subunits together form a methyltransferase (MTase) that methylates two adenine residues in complementary strands of bipartite DNA recognition sequence. In the presence of the r subunit the complex can also act as an endonuclease, binding to the same target sequence but cutting the DNA some distance from this site. Whether the DNA is cut or
modified depends on the methylation state of the target sequence. When the target site is unmodified, the DNA is cut. When the target site is hemimethylated, the complex acts as a maintenance MTase modifying the DNA so that both strands become methylated. Subunit s dictates DNA sequences specificity. The ECOAI enzyme recognizes 5'-gag(n7)gtca-3'. The type I restriction/modification system is composed of three polypeptides r,m and s. HsdS contains two DNA recognition domains, each specifying recognition of one of the two defined components of the target sequence and belongs to type-I restriction system S methylase family.

See also subunit m, NG0702, and subunit s, NG0699.

Oklahoma ID: NGO.697

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to type I restriction enzyme, site-specific deoxyribonuclease; e.g. residues 13-731 have 48% similarity to residues 8-740 of AF288038, S. thermophilus putative HsdR, residues 12-1004 have 33% similarity to residues 30-1043 of AE000561, H. pylori 26695 type I restriction enzyme R protein (hsdR).

Residues 101-680 are 24% similar to 11354217, type I restriction enzyme EcoR124II R protein of Neisseria meningitidis.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0610
COG name: Restriction enzymes type I helicase subunits and related helicases
Functional Class:  L
The phylogenetic pattern of COG0610 is aMt-----e--HUJ-P-----
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 596-689 are 53% similar to a (RESTRICTION TYPE ENZYME PROTEIN) protein domain (PD003073) which is seen in O25211_HELPY.

Residues 267-442 are 37% similar to a (RESTRICTION TYPE ENZYME I) protein domain (PD003184) which is seen in O25211_HELPY.

Residues 695-1004 are 18% similar to a (TYPE I RESTRICTION ENZYME) protein domain (PD132527) which is seen in O25211_HELPY.

Residues 460-526 are 46% similar to a (RESTRICTION PROTEIN TYPE I) protein domain (PD041102) which is seen in O25211_HELPY.

Residues 607-678 are 42% similar to a (PROTEIN ORF PUTATIVE KINASE) protein domain (PD000146) which is seen in YC14_METJA.

Residues 12-219 are 42% similar to a (TYPE I RESTRICTION ENZYME) protein domain (PD109872) which is seen in O25211_HELPY.



Paralogs:  Local Blast Search


NG0697 is paralogously related to NG0407 (type I restriction enzyme EcoR124II R protein (type I site-specific deoxyribonuclease EcoR124/3 chain)) (3e-30).


Pfam Summary:  Pfam Search
Residues 11 to 196 (E-value = 6.6e-27) place NG0697 in the HSDR_N family which is described as Type I restriction enzyme R protein N terminus (HSDR_N) (PF04313)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
215  
243
coil-coil  
675  
769
non-globular  
775  
856
coil-coil  
859  
893

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MTHYVTFMSQTHNENSRVKIPAVLHLMRLGYDYLSLKNANWDRQTNIFPE
IFVDSLCRINPDLPPDDARRLLADIRLELDNEDLGQKFYERLTNQSGGKK
LIDFQNFDNNSFHVVTELPCINGDEAFRPDIALLVNGMPLVFIEVKKPNN
KGGIGEERERMGKRAKNPKFRRFINITQFMIFSNNMEYDDGATEPAQGAF
YASSACGKPVFNYFREEHKLNLTELLDTLSDDLENNVLQDNNLPVIKHSP
EFISNKSPDTPTNRILTSLLCRERLSFLLQHGLTYVKASQGLVQKHIMRY
PQLFATLAIEKHLANGGKKGVIWHTQGSGKTALAYYNTRYLTHYYAKQGI
VPKFYFIVDRLDLLKQAQREFTARDLVVHTIDSREAFAADIKSAQTLHNH
AGKAEITVVNIQKFQDDPDVVARNDYDLAIQRVYFLDEVHRSYNPKGSFL
ANLNQSDVNAVKIGLTGTPLIGVTAGNVNTRELFGDYIHKYYYNASIADG
YTLRLIREEIGSRYKAQLQEALAQLEIEKGSFDRKEIYAHPHFVHPMLDY
ILDDFAKFRKTNQDESLGAMVVCDSAEQARQLFEHFQTASDHNFTAALIL
HDVGTKEERDQWVKDFKAGKIDILFVYNMLLTGFDAPRLKKLYLGRLIKA
HNLLQTLTRVNRTYKSYRYGYVVDFADIEREFDKTNRAYWDELSNELGDE
IGSYSQLFKTAEEIEQEIADIKNALFDFDTENAEEFCSQISQIEDKKQLL
ALKKALQTAKELYNILRLQGSHEFLAHLDFDKLNLLYRETAARLDTLNLA
EKLQQGDTAHLLNEALEDVYFQFVKIGEAELKLADDLKDIMRKVREGLAG
NFDQDDPEYISLREELERIFKKKNLAEVGQEEMQANIATLQTVYTKIKEP
NRQNDLLRHKYGGDAKYARIHKRLMENAALYGDKLKVFNALSGVKTDADQ
KVLDMEQILDNQNYFEKQMQGIVLKRFRTEQQFPVQPADIQAINRLLVRE
YLKESGRI

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCCATTACGTTACGTTTATGTCCCAAACCCACAACGAAAATTCCCG
CGTCAAAATCCCCGCCGTTTTGCACCTGATGCGCTTGGGCTATGATTATC
TTTCGCTAAAAAATGCAAATTGGGACAGACAAACCAATATCTTTCCCGAA
ATCTTTGTAGACAGCCTCTGCCGCATCAATCCCGATTTGCCGCCGGATGA
TGCACGCCGCCTGCTTGCCGACATACGCTTAGAGCTGGATAACGAAGATT
TGGGGCAAAAATTTTACGAACGCCTCACCAATCAATCCGGCGGTAAGAAG
CTGATCGATTTCCAAAATTTTGACAACAACAGTTTCCACGTTGTAACTGA
GTTGCCTTGTATCAACGGCGACGAAGCATTCCGCCCCGACATTGCCCTGT
TGGTAAACGGCATGCCTTTGGTCTTTATCGAAGTCAAAAAGCCCAACAAT
AAAGGCGGCATCGGCGAAGAGCGGGAGCGCATGGGCAAACGTGCGAAAAA
TCCCAAATTCCGCCGTTTTATCAACATCACCCAATTCATGATTTTTTCCA
ACAACATGGAATACGACGACGGCGCAACCGAGCCGGCACAAGGCGCGTTT
TACGCCTCGTCTGCTTGCGGCAAGCCCGTATTCAACTACTTCCGCGAAGA
GCATAAATTAAACCTTACCGAATTATTGGACACGCTTTCAGACGACCTTG
AAAACAACGTTCTACAAGACAACAACCTGCCCGTTATCAAACACAGCCCC
GAATTTATCAGCAATAAATCGCCCGATACGCCGACCAACCGCATCCTGAC
TTCGCTGCTTTGCCGCGAACGTCTTTCTTTTCTTCTGCAACACGGGCTGA
CTTACGTCAAAGCAAGTCAAGGCTTGGTGCAAAAACACATCATGCGGTAT
CCGCAGCTATTTGCCACCCTTGCCATTGAAAAACATTTGGCAAACGGCGG
CAAAAAAGGCGTGATTTGGCACACCCAAGGCTCTGGCAAAACCGCGCTTG
CCTATTACAACACCCGCTACCTGACCCACTATTATGCCAAACAGGGCATC
GTGCCGAAATTCTATTTCATCGTGGACAGGCTTGATTTATTGAAACAGGC
GCAGCGCGAATTTACTGCCCGCGATTTAGTCGTCCATACCATCGACAGCC
GCGAAGCCTTTGCTGCCGACATCAAATCCGCCCAAACTTTGCACAACCAC
GCAGGCAAAGCGGAAATCACTGTTGTTAATATCCAAAAATTCCAAGACGA
CCCCGATGTCGTCGCCCGTAACGACTACGACCTCGCCATTCAGCGCGTCT
ATTTTCTCGACGAAGTACACCGCAGCTACAACCCCAAAGGCTCATTTCTT
GCCAACCTTAATCAGTCCGACGTAAACGCCGTCAAAATCGGGCTGACCGG
CACGCCGCTTATCGGCGTAACCGCAGGCAACGTCAACACCCGCGAACTCT
TCGGCGACTACATCCACAAATACTATTACAACGCCTCCATTGCCGACGGC
TACACCCTGCGCCTGATACGCGAAGAAATCGGCAGCCGATACAAGGCGCA
ATTACAAGAAGCACTGGCGCAACTTGAAATCGAAAAAGGCAGCTTTGACC
GCAAAGAAATCTACGCCCATCCGCACTTCGTCCACCCGATGCTTGACTAC
ATCTTGGACGACTTCGCCAAATTCAGAAAAACCAACCAAGACGAGAGCCT
CGGTGCCATGGTCGTTTGCGACAGCGCAGAACAGGCACGCCAGCTTTTTG
AGCATTTTCAGACGGCCTCAGACCACAATTTCACCGCCGCGTTGATATTG
CACGACGTCGGCACTAAGGAAGAACGCGACCAATGGGTTAAAGATTTCAA
AGCGGGCAAAATCGACATCTTGTTTGTGTACAACATGCTTTTGACCGGCT
TTGACGCGCCGCGCCTGAAAAAGCTCTATTTGGGCAGACTGATAAAAGCC
CATAACCTTTTACAAACCCTGACCCGCGTCAACCGCACCTACAAATCTTA
CCGCTACGGCTATGTCGTCGATTTTGCCGATATCGAACGCGAATTTGACA
AAACCAACCGCGCCTATTGGGACGAACTTTCCAACGAATTGGGCGACGAA
ATCGGCAGTTACAGCCAGCTATTCAAAACCGCCGAAGAAATCGAACAGGA
AATTGCAGACATTAAAAACGCCCTGTTTGATTTCGATACCGAAAACGCCG
AAGAATTTTGCAGCCAAATTAGCCAAATAGAAGACAAAAAACAGCTTCTA
GCCTTAAAAAAAGCCCTGCAAACCGCCAAAGAGTTGTACAACATCCTGCG
CCTGCAAGGCAGCCACGAATTTCTTGCGCATCTGGATTTTGACAAGCTCA
ATCTTTTGTACCGCGAAACCGCCGCCCGCTTGGATACCTTAAACCTTGCC
GAAAAATTACAGCAAGGCGACACCGCCCATTTGCTCAATGAAGCGCTGGA
AGACGTTTACTTTCAATTCGTCAAAATCGGCGAGGCGGAACTCAAACTTG
CCGACGATTTGAAAGACATCATGCGCAAAGTCCGCGAAGGGCTGGCGGGC
AACTTCGACCAAGACGACCCCGAATACATCAGCCTGCGCGAAGAGCTGGA
ACGCATCTTCAAGAAAAAGAACCTCGCCGAAGTCGGGCAAGAAGAAATGC
AGGCAAACATCGCCACACTCCAAACCGTCTATACCAAAATCAAAGAGCCG
AACCGACAAAACGACCTCTTGCGGCACAAATACGGCGGCGACGCCAAATA
CGCACGTATCCACAAGCGGTTGATGGAAAACGCCGCCCTCTACGGAGACA
AACTCAAAGTCTTTAACGCGCTAAGCGGTGTAAAAACCGATGCCGACCAA
AAAGTGCTGGATATGGAGCAGATTTTGGACAACCAAAATTACTTTGAAAA
ACAAATGCAAGGCATCGTATTAAAACGCTTTAGAACGGAACAGCAATTTC
CTGTTCAGCCTGCAGACATCCAAGCCATCAACCGCCTGTTGGTGCGGGAA
TATTTAAAAGAAAGCGGGCGGATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy