Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0582.1 IGR0580 IGR0581 IGR0582.3 IGR0577 IGR0579 IGR0578 IGR0582 IGR0582.2 NG0690 NG0691.1 NG0691 fenR, - NG0687 NG0688 thrC, - NG0689 NG0694 NG0686 NG0692 NG0685 NG0690 NG0691.1 NG0691 fenR, - NG0687 NG0688 thrC, - NG0689 NG0694 NG0686 NG0692 NG0685 NG0690 NG0691 fenR, - NG0687 NG0688 thrC, - NG0689 NG0693 NG0694 NG0691.1 NG0693 NG0686 NG0685 NG0692.1 NG0692 NG0692.1
* Calculated from Protein Sequence

Gene ID: NG0689

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
thrC  

Definition:
threonine synthase

Gene Start:
680884

Gene Stop:
679478

Gene Length:
1407

Molecular Weight*:
51468

pI*:
5.40

Net Charge*:
-8.32

EC:
4.2.99.2  

Functional Class:
Amino acid biosynthesis; Aspartate family  

Pathway: pathway table
Glycine, serine and threonine metabolism
Vitamin B6 metabolism

Secondary Evidence:
Motoyama,H., Maki,K., Anazawa,H., Ishino,S. and Teshiba,S. Cloning and nucleotide sequences of the homoserine dehydrogenase genes (hom) and the threonine synthase genes (thrC) of thegram-negative obligate methylotroph Methylobacillus glycogenes. Appl. Environ. Microbiol. 60 (1): 111-119 (1994) [Medline: 94161493].

Clepet,C., Borne,F., Krishnapillai,V., Baird,C., Patte,J.C. and Cami,B.
Isolation, organization and expression of the Pseudomonas aeruginosa threonine genes.
Mol. Microbiol. 6 (21): 3109-3119 (1992)
Medline: 93086420.

Fernandez M, Cuadrado Y, Recio E, Aparicio JF, Martin JF.
Characterization of the hom-thrC-thrB cluster in aminoethoxyvinylglycine-producing Streptomyces sp. NRRL 5331.
Microbiology. 2002 May;148(Pt 5):1413-20.
PMID: 11988515

Malumbres M, Mateos LM, Lumbreras MA, Guerrero C, Martin JF.
Analysis and expression of the thrC gene of Brevibacterium lactofermentum and characterization of the encoded threonine synthase.
Appl Environ Microbiol. 1994 Jul;60(7):2209-19.
PMID: 8074505



Comment:
From GenBANK (gi:12231046): This protein catalyzes the reaction: o-phospho-l-homoserine + H2O = l-threonine + orthophosphate, requiring a cofactor, pyridoxal phosphate. This is involved in threonine biosynthesis.

Oklahoma ID: NGO.689c

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to threonine synthase; e.g. residues 1-468 are 57% similar to AE001863 of Deinococcus radiodurans.

Residues 1-469 have 97% similarity to N. meningitidis MC58 threonine synthase (11269519), and to NMA1440 threonine synthase N. meningitidis Z2491 (11269515).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0498
COG name: Threonine synthase
Functional Class:  E
The phylogenetic pattern of COG0498 is AmtKyQvCebrhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000634 (Serine/threonine dehydratase pyridoxal-phosphate attachment site) with a combined E-value of 1.3e-09.
    IPB000634A    102-116
    IPB000634B    254-264
    IPB000634C    265-284


ProDom Summary:  Protein Domain Search
Residues 1-464 are 61% similar to a (THREONINE SYNTHASE LYASE BIOSYNTHESIS PYRIDOXAL) protein domain (PD005074) which is seen in THRC_METGL.



Paralogs:  Local Blast Search


NG0689 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 79 to 417 (E-value = 6.9e-21) place NG0689 in the PALP family which is described as Pyridoxal-phosphate dependent enzyme (PF00291)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
383  
469

PDB Hit:
pdb|1KL7|1KL7-A CRYSTAL STRUCTURE OF THREONINE SYNTHASE FROM 330.0 3e-91
pdb|1E5X|1E5X-A STRUCTURE OF THREONINE SYNTHASE FROM ARABIDOPSIS 42.3 2e-04
pdb|1KL7|1KL7-A CRYSTAL STRUCTURE OF THREONINE SYNTHASE FROM 646.0 0.000000
pdb|1E5X|1E5X-A ST

Gene Protein Sequence:
MRYISTRGETAHKPFSEVLLMGLAPDGGLMLPEHYPQIGRETLDKWRGLA
YPELAFEIMCLFVTDIPEDDLRDILNRTYTEAAFGTKEITPVRTLSDGIK
IQALSNGPTLAFKDMAMQFLGNAFEYVLNKEGKKLNILGATSGDTGSAAE
YALRGKKGVNVFMLSPDGKMSAFQRAQMYSLQDGNIHNIAVKGMFDDCQD
IVKAVQNDAAFKEKYHIGTVNSINWGRIVAQVVYYFAGYFNATSSNDETV
SFCVPSGNFGNVCAGHIAKQMGLPVRCLIVATNENDVLDEFFKTGAYRPR
NSAHTYVTSSPSMDISKASNFERFVFDLMDRDPQEINTLWAEVAAGKGFD
LRFALDKVGGKYGFTSGKSTHADRLATIRQVYEQDKELIDPHTANGVKVA
REVREAGETVVCLETALAAKFDATIREAVGDVAIPRPAALEGLENLPQRV
QTVPNSADAVKGIIEQTLA

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGATACATCAGCACGCGCGGCGAAACCGCACACAAACCGTTCAGCGA
AGTTTTATTGATGGGGCTTGCACCCGACGGCGGACTGATGCTGCCGGAAC
ATTATCCGCAAATCGGGCGCGAAACCTTGGACAAATGGCGCGGTTTGGCT
TATCCCGAATTGGCGTTTGAAATCATGTGCCTGTTCGTTACCGATATTCC
GGAGGACGATTTGCGCGACATTCTGAACCGTACTTACACGGAAGCGGCGT
TCGGTACTAAGGAAATCACCCCCGTCCGCACGCTTTCAGACGGCATCAAA
ATCCAAGCCTTGTCCAACGGCCCGACGCTGGCGTTCAAAGATATGGCGAT
GCAGTTTTTGGGCAATGCGTTTGAATATGTTTTAAACAAAGAAGGCAAAA
AACTCAATATCTTGGGCGCAACCAGCGGCGATACGGGTTCGGCTGCGGAA
TATGCCTTGCGCGGCAAAAAAGGCGTGAACGTATTTATGTTGTCGCCCGA
CGGTAAAATGAGCGCGTTCCAACGCGCGCAGATGTACAGCCTGCAAGACG
GGAATATCCACAATATCGCCGTGAAGGGGATGTTTGACGACTGCCAGGAC
ATTGTGAAGGCAGTGCAGAACGATGCCGCGTTCAAGGAAAAATACCATAT
CGGTACGGTCAATTCGATCAACTGGGGGCGCATCGTCGCGCAAGTGGTTT
ATTACTTTGCAGGCTATTTCAATGCCACTTCAAGCAATGACGAAACCGTC
AGCTTTTGCGTACCGAGCGGCAACTTCGGCAACGTTTGCGCGGGACACAT
CGCCAAACAAATGGGCCTGCCTGTCCGCTGCCTGATTGTCGCGACCAATG
AAAACGATGTGCTGGACGAGTTTTTCAAAACCGGCGCATACCGCCCGCGC
AACAGCGCGCATACTTATGTAACCTCCAGCCCGTCTATGGACATTTCCAA
AGCGTCCAACTTCGAGCGTTTCGTGTTCGACCTGATGGATCGCGATCCTC
AGGAAATCAATACGCTGTGGGCGGAAGTCGCGGCAGGCAAAGGCTTTGAC
CTGCGGTTTGCCTTGGACAAAGTCGGCGGCAAATACGGCTTTACCTCCGG
CAAATCTACCCACGCCGACCGCCTCGCCACCATCAGACAGGTTTACGAGC
AAGACAAAGAACTCATCGACCCGCATACTGCCAACGGCGTAAAAGTCGCC
CGCGAAGTGCGCGAAGCGGGGGAAACGGTGGTTTGTTTGGAAACCGCGTT
GGCGGCGAAATTCGATGCGACCATACGCGAAGCCGTCGGCGATGTCGCCA
TTCCGCGCCCCGCCGCGCTGGAAGGTTTGGAAAACCTGCCGCAGCGCGTG
CAAACCGTGCCGAACAGTGCGGATGCGGTAAAAGGCATCATCGAACAAAC
CCTTGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy