Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0580 IGR0574 IGR0576 IGR0575 IGR0577 IGR0579 IGR0578 fenR, - NG0687 NG0688 thrC, - NG0689 NG0686 radC, - NG0681 NG0682 hlfX, - NG0684 NG0683 NG0685 fenR, - NG0687 NG0688 thrC, - NG0689 NG0686 radC, - NG0681 NG0682 hlfX, - NG0684 NG0683 NG0685 fenR, - NG0687 NG0688 thrC, - NG0689 NG0686 radC, - NG0681 NG0682 hlfX, - NG0684 NG0683 NG0685
* Calculated from Protein Sequence

Gene ID: NG0685

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
cation transport ATPase, E1-E2 family

Gene Start:
674546

Gene Stop:
676999

Gene Length:
2454

Molecular Weight*:
88759

pI*:
6.30

Net Charge*:
-6.69

EC:
3.6.1.-  

Functional Class:
Transport and binding proteins; Cations  

Pathway: pathway table
Folate biosynthesis
Starch and sucrose metabolism

Comment:
From GenBANK (2493001): In Synechocystis sp., this cation transporting ATPase may play a role in the osmotic adaptation. Catalytic activity: ATP + H2O = ADP + phosphate. This integral membrane protein belongs to the cation transport ATPases family (E1-E2 ATPases) and contains 1 heavy-metal-associated (HMA) domain.

Oklahoma ID: NGO.685

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to cation transport ATPases, E1-E2 family; e.g. residues 5-808 are 41% similar to AE004583 of Pseudomonas aeruginosa.

NG0686 is similar to AE002454: residues 1-818 have 94% similarity to N. meningitidis MC58 cation transport ATPase, E1-E2 family (11267403), and to the same protein in N. meningitidis Z2491 (11267399).

COGS Summary:  COGS Search
BeTs to 12 clades of COG2217
COG name: Cation transport ATPases
Functional Class:  P
The phylogenetic pattern of COG2217 is AmT-YQvCEBRhUJ---lin-
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB001757 (E1-E2 ATPases) with a combined E-value of 9.2e-18.
    IPB001757A    509-520
    IPB001757B    697-726
***** IPB001934 (Heavy-metal-associated domain) with a combined E-value of 1.5e-08.
    IPB001934A    97-119
    IPB001934B    508-518


ProDom Summary:  Protein Domain Search
Residues 618-721 are 35% similar to a (ATPASE PROBABLE COPPER-TRANSPORTING) protein domain (PD037883) which is seen in ATU1_YEAST.

Residues 537-665 are 31% similar to a (PROBABLE COPPER-TRANSPORTING ATPASE SYNA) protein domain (PD169626) which is seen in ATSY_SYNP7.

Residues 438-520 are 38% similar to a (ATPASE HYDROLASE TRANSMEMBRANE PHOSPHORYLATION) protein domain (PD000466) which is seen in FIXI_RHILE.

Residues 660-722 are 55% similar to a (ATPASE HYDROLASE TRANSMEMBRANE PHOSPHORYLATION) protein domain (PD000121) which is seen in FIXI_BRAJA.

Residues 728-810 are 49% similar to a (ATPASE HYDROLASE TRANSMEMBRANE PHOSPHORYLATION) protein domain (PD000140) which is seen in O32220_BACSU.

Residues 298-380 are 54% similar to a (ATPASE HYDROLASE TRANSMEMBRANE PHOSPHORYLATION) protein domain (PD000132) which is seen in O67203_AQUAE.



Paralogs:  Local Blast Search


NG0685 is paralogously related to NG0579 (cation transport ATPase protein) (3e-95).


Pfam Summary:  Pfam Search
Residues 279 to 502 (E-value = 2.9e-61) place NG0685 in the E1-E2_ATPase family which is described as E1-E2 ATPase (PF00122)
Residues 506 to 729 (E-value = 9.7e-24) place NG0685 in the Hydrolase family which is described as haloacid dehalogenase-like hydrolase (PF00702)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
93  
109
transmembrane  
214  
230
transmembrane  
249  
265
transmembrane  
271  
287
transmembrane  
429  
445
non-globular  
435  
536
transmembrane  
459  
475
non-globular  
706  
818
transmembrane  
766  
782

PDB Hit:
pdb|1MHS|1MHS-A MODEL OF NEUROSPORA CRASSA PROTON ATPASE 100.0 9e-22
pdb|1EUL|1EUL-A CRYSTAL STRUCTURE OF CALCIUM ATPASE WITH TWO 56.2 2e-08
pdb|1AFI|1AFI STRUCTURE OF THE REDUCED FORM OF MERP, THE 41.4 6e-04
pdb|1FVQ|1FVQ-A SOLU

Gene Protein Sequence:
MKKTCFHCGLDVPENLHLTVRYEGEDRETCCVGCQAVAQSIIDSGLGSYY
KRRTADAKKTELPPQEILDQIRLYDLPEVQSDFVETHNGTHEAVLMLSGI
TCAACVWLIEQQLLRTDGIVRIDLNYSTHRCRVVWDDGKIRLSDILLKIR
QTGYTAAPYDAQKIEAANQKERKQYIVRLAVAGLGMMQTMMFALPTYLYG
GDIEPDFLQILHWGGFLMVLPVVFYCAVPFYQGALRDLKNRRAGMDTPIA
AAIIMTFIAGIYSLATNAGQGMYFESIAMLLFFLLGGRFMEHIARRKAGD
AAERLVKLIPAFCHRMPGYPAVQDVRESAVVKLQAGDIVMVKPGETIPVD
GTVLEGNSAVNESMLTGESLPVAKMPSEKVTAGTLNTQSPLIIRTDRTGG
GTRLSHIVRLLDRALAQKPRTAELAEQYASSFIFGELLLAVPVFIGWTLY
ADAHTALWITVALLVITCPCALSLATPTALAASTGTLAREGILIGGKQAI
ETLSQTTDIIFDKTGTLTQGNPAVRRIELLGSMTEAQVLAVAQSLEQQSE
HPLARAILNCRISGGSVPEIQVGQRLNRIGEGVGAQLTVNGETQVWALGR
ASYVAEISGKEPQTEGGGSAVYLGSQSGFQAVFYLQDPLKDSAAEAVRQL
AGKNLTLHILSGDREEAVAETARALGIAHYRAQAMPEDKLEYVEALQKEG
KKVLMIGDGINDAPVLAQADVSAAAVGGTDIARDGADIVLLNEDLRTVAH
LLDQARRTRHIIRQNLIWAGAYNIIAVPLAVLGYVQPWIAALGMSFSSLA
VLGNALRLHKRGEMPSEQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAAACCTGTTTCCACTGCGGGCTGGACGTTCCCGAAAACCTGCA
TCTGACCGTCCGCTACGAAGGCGAAGACCGCGAAACCTGCTGCGTCGGCT
GTCAGGCAGTCGCACAAAGCATCATCGATTCCGGCTTGGGCAGTTATTAC
AAACGACGCACCGCCGACGCGAAAAAAACCGAACTGCCGCCCCAAGAAAT
CCTCGACCAAATCCGCCTGTACGACCTGCCCGAAGTCCAATCCGACTTTG
TGGAAACCCATAATGGCACGCACGAAGCAGTGCTGATGCTCAGCGGCATT
ACCTGCGCCGCCTGCGTCTGGCTGATCGAACAGCAGCTTTTGCGCACAGA
CGGCATCGTCCGCATCGACCTCAATTACAGCACGCACCGCTGCCGCGTCG
TCTGGGACGACGGCAAAATCCGCCTCTCCGACATTCTGTTGAAAATCCGG
CAGACAGGCTACACCGCCGCACCCTATGACGCGCAAAAAATCGAAGCCGC
CAACCAAAAAGAACGCAAACAATACATCGTCCGCCTTGCCGTTGCCGGAC
TGGGTATGATGCAGACGATGATGTTCGCGCTGCCGACCTACCTTTACGGC
GGCGACATCGAACCCGATTTCCTGCAGATCCTCCATTGGGGCGGCTTCCT
GATGGTGCTGCCCGTCGTATTTTATTGCGCCGTCCCGTTTTATCAAGGCG
CGTTGCGCGACCTGAAAAACCGCCGCGCCGGTATGGACACGCCGATTGCC
GCCGCCATCATCATGACCTTCATCGCCGGCATTTACAGCCTCGCCACCAA
CGCAGGGCAGGGGATGTATTTCGAATCCATCGCGATGCTGCTGTTTTTCC
TGCTGGGCGGACGCTTTATGGAACACATTGCCCGACGCAAGGCAGGCGAT
GCCGCCGAAAGGCTGGTGAAACTGATACCCGCCTTCTGCCACCGGATGCC
CGGCTATCCTGCCGTACAGGATGTCCGCGAATCCGCCGTCGTCAAACTCC
AAGCAGGCGATATTGTGATGGTCAAACCCGGCGAAACCATCCCCGTTGAC
GGCACGGTGCTGGAAGGAAACAGTGCCGTCAACGAATCTATGCTGACCGG
CGAGAGCCTGCCCGTCGCCAAAATGCCGTCTGAAAAAGTAACCGCAGGTA
CACTCAACACGCAAAGCCCTCTGATTATACGCACCGACCGCACCGGCGGC
GGCACGCGCCTGTCGCACATCGTCCGCCTGCTCGACCGCGCCTTGGCGCA
AAAACCGCGCACTGCCGAGTTGGCGGAACAATACGCCTCATCTTTCATAT
TCGGCGAGCTCCTGCTTGCCGTCCCGGTCTTCATCGGTTGGACGCTGTAC
GCCGACGCGCACACCGCATTGTGGATTACCGTCGCCCTGCTGGTCATTAC
CTGCCCCTGCGCCCTGTCGCTTGCCACGCCGACCGCGCTGGCAGCTTCTA
CCGGTACGCTGGCGCGCGAAGGTATTTTAATCGGCGGAAAGCAGGCAATC
GAAACCCTCTCCCAAACCACCGACATCATTTTCGACAAAACCGGCACGCT
GACCCAAGGCAATCCCGCCGTCCGCCGGATTGAACTGCTCGGCAGCATGA
CCGAAGCCCAAGTGCTGGCAGTGGCGCAAAGTTTGGAACAGCAGTCAGAA
CACCCGCTCGCGCGCGCCATCCTCAACTGCCGCATTTCAGGCGGCAGCGT
CCCCGAAATCCAAGTCGGACAACGCCTCAACCGCATCGGGGAAGGCGTGG
GTGCGCAACTGACCGTCAACGGCGAAACACAGGTTTGGGCATTGGGGAGG
GCATCCTATGTTGCCGAAATTTCAGGTAAAGAACCGCAAACAGAAGGCGG
CGGCAGCGCGGTTTACCTCGGCAGTCAAAGCGGTTTCCAAGCCGTGTTCT
ACCTGCAAGACCCGCTCAAAGACAGCGCGGCGGAGGCAGTGCGGCAGTTG
GCAGGCAAAAACCTGACGCTGCACATCCTCAGTGGCGACCGTGAAGAAGC
AGTTGCTGAAACCGCCCGTGCCTTGGGTATCGCGCACTACCGCGCCCAAG
CAATGCCGGAAGACAAGCTGGAATACGTCGAAGCCTTGCAAAAAGAAGGG
AAAAAAGTGCTGATGATAGGCGACGGCATCAACGACGCGCCCGTTTTGGC
GCAGGCAGACGTATCCGCCGCCGCAGTCGGCGGGACGGATATTGCGAGGG
ACGGCGCAGACATTGTGTTATTGAACGAAGATTTGCGTACCGTCGCCCAC
CTGCTCGATCAGGCGCGGCGCACCCGCCATATCATCCGGCAAAACCTGAT
ATGGGCGGGCGCGTACAATATCATTGCCGTACCGCTTGCCGTTTTGGGCT
ATGTCCAACCGTGGATAGCCGCACTGGGTATGAGCTTCAGTTCGCTGGCG
GTTTTGGGCAACGCCCTGCGCCTTCACAAACGGGGGGAAATGCCGTCCGA
ACAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy