Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0568 IGR0570 IGR0574 IGR0576 IGR0571 IGR0573 IGR0575 IGR0569 IGR0572 NG0678 leuD, - NG0677 rngoV, - NG0675 mtb5,mngoV, - NG0676 leuC,leu3, - NG0679 radC, - NG0681 NG0682 hlfX, - NG0684 gshA, - NG0680 NG0683 NG0685 NG0678 leuD, - NG0677 rngoV, - NG0675 mtb5,mngoV, - NG0676 leuC,leu3, - NG0679 radC, - NG0681 NG0682 hlfX, - NG0684 gshA, - NG0680 NG0683 NG0685 NG0678 leuD, - NG0677 rngoV, - NG0675 mtb5,mngoV, - NG0676 leuC,leu3, - NG0679 radC, - NG0681 NG0682 gshA, - NG0680 NG0683 NG0685 hlfX, - NG0684
* Calculated from Protein Sequence

Gene ID: NG0680

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gshA  

Definition:
probable glutamate-cysteine ligase

Gene Start:
669166

Gene Stop:
670332

Gene Length:
1167

Molecular Weight*:
42780

pI*:
4.70

Net Charge*:
-16.80

EC:
6.3.2.2  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Thioredoxin, glutaredoxin, and glutathione  

Pathway: pathway table
Glutamate metabolism
Glutathione metabolism

Secondary Evidence:
Powles,R., Deane,S. and Rawlings,D.
The gene for gamma-glutamylcysteine synthetase from Thiobacillus ferrooxidans has low homology to its Escherichia coli equivalent and is linked to the gene for citrate synthase. Microbiology 142 (Pt 9): 2543-2548 (1996)
[Medline: 96425880].

Comment:
Oklahoma ID: NGO.680

Blast Summary:  PSI-Blast Search
Three significant hits in gapped BLAST to probable glutamate-cysteine ligase; e.g. residues 2-387 are 46% similar to U81808 of Thiobacillus ferrooxidans.

NG0680 is orthologous to N. meningitidis MC58 glutamate--cysteine ligase : residues 91-433 have 97% similarity to residues 31-373 in NG0680 (11280936). Also similar to probable glutamate--cysteine ligase, N.meningitidis Z2491 (11280937).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 37-321 are 52% similar to a (GLUTAMATE--CYSTEINE LIGASE EC 6.3.2.2) protein domain (PD141010) which is seen in Q56277_THIFE.



Paralogs:  Local Blast Search


NG0680 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
188  
215

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MNLFPGGFNNLNPNFIPLAAVAAQDAVQRACETEKSVLIIPENHTRNTFY
LQNVYALGEIFRSAGCEVRLGSLNPEVTEPAEFETALGDKILLEPLLRTR
DRVHLADGFSPCVVLLNNDLSAGIPDILKGIGQTVLPPLHGGWTTRRKTN
HFGAYNQVAAEFAKLIDIDEWQINPYFEKIGGLDFQGREGEDALAEAVER
VLAKIQAKYDESGIADKPFVIVKADAGTYGMGVMSVKSSDEVRGLNRKNR
NKMAKVKEGLEVSEVIVQEGVYTYETLNGAVCEPVVYMMDRFVIGGFFRV
HEGRGADENLNAGGMVFVPLSNSIPTGNGDNSQEAPEACKRVFEQWDSLG
MPRSEKDCDVDNEHNRLYVYGVMARLSLLAASIELEETA

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATTTGTTTCCGGGCGGCTTCAATAATCTGAATCCGAATTTCATCCC
GCTGGCGGCGGTTGCCGCGCAAGATGCGGTGCAACGCGCCTGCGAAACGG
AGAAATCCGTATTGATTATTCCCGAAAACCACACGCGCAATACGTTTTAC
CTGCAAAACGTTTACGCCCTCGGCGAGATTTTCCGTTCGGCAGGGTGTGA
AGTGCGCTTGGGCAGCCTGAATCCGGAAGTAACCGAACCGGCCGAATTTG
AAACTGCATTGGGCGACAAAATCCTGCTTGAGCCTTTGCTGCGAACCCGC
GACCGCGTCCACCTTGCCGACGGCTTTTCGCCTTGCGTGGTTTTGTTGAA
CAACGATTTGTCCGCCGGCATTCCCGACATTCTCAAAGGCATCGGCCAAA
CCGTTTTGCCGCCGCTGCACGGCGGTTGGACGACGCGCCGCAAAACAAAT
CATTTCGGCGCGTACAACCAAGTTGCCGCCGAATTTGCCAAGCTGATTGA
CATCGATGAATGGCAGATCAACCCGTATTTTGAAAAAATCGGCGGTTTGG
ACTTCCAAGGGCGCGAAGGTGAAGATGCGCTGGCGGAAGCGGTAGAACGC
GTGCTGGCGAAAATTCAAGCCAAATACGACGAATCGGGCATTGCCGACAA
ACCTTTCGTCATCGTCAAAGCCGATGCCGGCACTTACGGCATGGGTGTGA
TGAGCGTCAAATCCTCCGACGAAGTGCGCGGCTTGAACCGCAAAAACCGC
AACAAAATGGCGAAGGTGAAAGAGGGCTTGGAAGTCAGCGAAGTGATTGT
CCAAGAAGGGGTTTATACCTATGAAACCTTGAACGGCGCGGTGTGCGAAC
CCGTCGTCTATATGATGGACCGTTTCGTCATCGGCGGCTTTTTCCGCGTA
CACGAAGGGCGCGGTGCGGACGAAAACCTCAACGCCGGCGGTATGGTGTT
TGTGCCGCTGTCCAACAGCATTCCTACCGGTAACGGCGATAATTCGCAAG
AAGCTCCAGAAGCCTGCAAACGCGTATTCGAACAATGGGATTCGCTCGGT
ATGCCGCGTTCTGAAAAAGACTGCGACGTGGACAACGAACATAACCGCCT
CTACGTTTACGGCGTAATGGCACGTCTGTCGCTTTTGGCGGCTTCAATCG
AGTTGGAAGAAACGGCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy