Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0568 IGR0567 IGR0570 IGR0574 IGR0571 IGR0573 IGR0575 IGR0569 IGR0572 NG0678 leuD, - NG0677 rngoV, - NG0675 leu3, - NG0674 mtb5,mngoV, - NG0676 leuC,leu3, - NG0679 radC, - NG0681 NG0682 gshA, - NG0680 NG0683 NG0678 leuD, - NG0677 rngoV, - NG0675 leu3, - NG0674 mtb5,mngoV, - NG0676 leuC,leu3, - NG0679 radC, - NG0681 NG0682 gshA, - NG0680 NG0683 NG0678 leuD, - NG0677 rngoV, - NG0675 leu3, - NG0674 mtb5,mngoV, - NG0676 leuC,leu3, - NG0679 radC, - NG0681 NG0682 gshA, - NG0680 NG0683
* Calculated from Protein Sequence

Gene ID: NG0679

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
leuC  leu3  

Definition:
3-isopropylmalate dehydratase large subunit

Gene Start:
668734

Gene Stop:
667328

Gene Length:
1407

Molecular Weight*:
50464

pI*:
5.70

Net Charge*:
-9.40

EC:
4.2.1.33  

Functional Class:
Amino acid biosynthesis; Branched chain amino acid family  

Pathway: pathway table
Valine, leucine and isoleucine biosynthesis

Primary Evidence:
Lau,P.C., Forghani,F., Labbe,D., Bergeron,H., Brousseau,R. and Holtke,H.J.
The NlaIV restriction and modification genes of Neisseria lactamica are flanked by leucine biosynthesis genes.
Mol. Gen. Genet. 243 (1): 24-31 (1994)
[Medline: 94247353].

Secondary Evidence:
Manna,A.C. and Das,H.K.
Characterization and mutagenesis of the leucine biosynthetic genes of Azotobacter vinelandii: an analysis of the rarity of amino acid auxotrophs.
Mol. Gen. Genet. 254 (2): 207-217 (1997)
[Medline: 97261869].

Comment:
From GenBANK (gi:2498515): The enzyme complex catalyzes two reactions: 1) 3-isopropylmalate = 2-isopropylmaleate + H2O and 2) 2-isopropylmaleate + H2O = 3-hydroxy-4-methyl-3-carboxypentanone). This is involved in the second step in leucine biosynthesis. The complex consists of two different subunits: leuC and leuD.

See leuD, small subunit, NG0677.

May serve as acn1 (acnA). See NG1231.

Oklahoma ID: NGO.679c

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to 3-isopropylmalate dehydratase large subunit; e.g. residues 1-468 are 67% similar to AE004736 of Pseudomonas aeruginosa.

NG0679 is similar to AL162756, N. meningitidis Z249 3-isopropylmalate dehydratase large subunit: residues 1-469 have 96% similarity to residues 1-469 in NG0679 (11280214). Also similar to NMB1036 of N.meningitidis MC58 (11280216).

Residues 125-461 are 26% similar to the E.coli acnA (aconitase 1).( g113158)

COGS Summary:  COGS Search
BeTs to 11 clades of COG0065
COG name: 3-Isopropylmalate dehydratase large subunit
Functional Class:  E
The phylogenetic pattern of COG0065 is AMTkyqVcEbrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001030 (Aconitase (aconitate hydratase)) with a combined E-value of 5.2e-56.
    IPB001030A    197-245
    IPB001030B    392-415
    IPB001030C    427-441
    IPB001030A    137-185
***** IPB000573 (Aconitase C-terminal domain) with a combined E-value of 1.2e-07.
    IPB000573    190-239


ProDom Summary:  Protein Domain Search
Residues 5-460 are 58% similar to a (LYASE IRON-SULFUR 4FE-4S ISOMERASE) protein domain (PD000511) which is seen in LEU2_RHIPU.

Residues 1-40 are 60% similar to a (3-ISOPROPYLMALATE DEHYDRATASE LARGE) protein domain (PD137565) which is seen in LEU2_AZOVI.



Paralogs:  Local Blast Search


NG0679 is paralogously related to NG1231 (aconitate hydratase 2) (8e-15) and NG1522 (aconitate hydratase (possible isopropylmalate dehydratase)) (1e-14).


Pfam Summary:  Pfam Search
Residues 5 to 460 (E-value = 5e-233) place NG0679 in the Aconitase family which is described as Aconitase family (aconitate hydratase) (PF00330)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
103  
210

PDB Hit:
pdb|1NIS|1NIS ACONITASE (E.C.4.2.1.3) COMPLEX WITH NITROCITRATE101.0 3e-22
pdb|1B0J|1B0J-A CRYSTAL STRUCTURE OF ACONITASE WITH ISOCITRATE 101.0 3e-22
pdb|1B0K|1B0K-A S642A:FLUOROCITRATE COMPLEX OF ACONITASE 101.0 3e-22
pdb|5ACN|5ACN ACONI

Gene Protein Sequence:
MTAQTLYDKLWNSHVVREEGDGTVLLYIDRHLVHEVTSPQAFEGLKMAGR
KLWRIDSVVSTADHNTPTGDWDKGIQDPISKLQVDTLDQNIKEFGALAYF
PFMDKGQGIVHVMGPEQGATLPGMTVVCGDSHTSTHGAFGALAHGIGTSE
VEHTMATQCITAKKSKSMLIAADGKLKAGVTAKDVALYIIGQIGTAGGTG
YAVEFGGEAIRSLSMEGRMTLCNMAIEAGARSGMVAVDQTTIDYVKGKPF
APEGEAWDKAVEYWRTLVSDEGAVFDKEYRFNAEDIEPQVTWGTSPEMVL
NIGGKVPNPAEETDPVKRSGIERALEYMGLKAGTPLNEIPVDIVFIGSCT
NSRIEDLREAAAIAKGHKKAGNVQRVLIVPGSGLVKEQAEKEGLDKIFIE
AGFEWREPGCSMCLAMNADRLAPRQRCASTSNRNFEGRQGNGGRTHLVSP
AMAAAAAVTGHFTDIRTMA

Gene Nucleotide Sequence:  Sequence Viewer
ATGACGGCACAAACCCTCTACGACAAACTCTGGAACAGCCACGTCGTCCG
CGAAGAAGGAGACGGCACCGTCCTGCTTTACATCGACCGCCATCTGGTTC
ACGAAGTAACCAGCCCGCAGGCGTTTGAAGGTCTGAAAATGGCGGGGCGC
AAGCTGTGGCGCATCGACAGCGTGGTCTCCACCGCCGACCACAACACCCC
GACCGGCGATTGGGACAAAGGCATCCAAGACCCGATTTCCAAGCTGCAAG
TCGATACGTTGGATCAAAACATCAAAGAGTTTGGCGCACTCGCCTACTTC
CCGTTTATGGACAAAGGCCAGGGCATCGTACACGTTATGGGGCCCGAACA
AGGCGCGACCCTGCCCGGGATGACCGTCGTCTGCGGCGATTCGCACACTT
CCACCCACGGCGCATTCGGCGCACTGGCACACGGCATCGGCACTTCCGAA
GTCGAACACACGATGGCGACCCAGTGCATTACCGCGAAAAAATCCAAATC
TATGCTGATTGCCGCTGACGGCAAATTAAAAGCGGGCGTTACCGCCAAAG
ACGTGGCGCTCTACATCATCGGGCAAATCGGCACGGCGGGCGGCACGGGT
TACGCCGTCGAGTTCGGCGGCGAAGCCATCCGCAGCCTTTCGATGGAAGG
CAGGATGACCCTGTGCAATATGGCGATTGAGGCAGGCGCGCGTTCCGGTA
TGGTTGCCGTCGATCAAACCACCATCGACTATGTCAAAGGCAAGCCCTTC
GCACCCGAAGGCGAAGCTTGGGACAAAGCCGTCGAGTACTGGCGCACGCT
GGTGTCTGACGAAGGCGCGGTTTTTGATAAAGAATACCGTTTCAACGCCG
AAGACATCGAACCGCAAGTTACTTGGGGCACGTCGCCCGAAATGGTTTTA
AACATCGGCGGCAAAGTGCCGAATCCCGCCGAAGAAACCGATCCGGTCAA
ACGCAGCGGCATAGAGCGCGCACTCGAATATATGGGTTTGAAGGCCGGTA
CGCCGCTGAACGAAATCCCTGTCGATATCGTCTTTATCGGCTCTTGCACC
AACAGCCGCATCGAAGACTTGCGCGAAGCCGCTGCTATCGCCAAAGGCCA
TAAAAAAGCCGGCAACGTACAGCGCGTGTTAATCGTCCCCGGCTCCGGTT
TGGTTAAAGAACAAGCCGAAAAAGAAGGCTTGGACAAAATTTTCATCGAA
GCCGGTTTTGAATGGCGCGAACCGGGCTGTTCGATGTGCCTTGCGATGAA
TGCCGACCGCCTCGCGCCGAGGCAACGCTGCGCCTCCACGTCCAACCGCA
ATTTTGAAGGCCGCCAAGGCAACGGCGGGCGCACCCACCTCGTCAGCCCC
GCTATGGCCGCCGCCGCCGCCGTTACCGGACACTTTACCGACATCCGCAC
GATGGCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy