Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0568 IGR0566 IGR0567 IGR0563 IGR0570 IGR0571 IGR0565 IGR0569 IGR0564 IGR0572 NG0678 leuD, - NG0677 rngoV, - NG0675 spoU, - NG0670 NG0669 leu3, - NG0674 mtb5,mngoV, - NG0676 leuC,leu3, - NG0679 NG0672 tpn, - NG0673 suhB, - NG0671 gshA, - NG0680 NG0678 leuD, - NG0677 rngoV, - NG0675 spoU, - NG0670 NG0669 leu3, - NG0674 mtb5,mngoV, - NG0676 leuC,leu3, - NG0679 NG0672 tpn, - NG0673 suhB, - NG0671 gshA, - NG0680 NG0678 leuD, - NG0677 rngoV, - NG0675 spoU, - NG0670 NG0669 leu3, - NG0674 mtb5,mngoV, - NG0676 leuC,leu3, - NG0679 tpn, - NG0673 suhB, - NG0671 gshA, - NG0680 NG0672
* Calculated from Protein Sequence

Gene ID: NG0675

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rngoV  

Definition:
type II restriction enzyme (of a res/mod system), Ngo(V) (Neisseria-specific)

Gene Start:
664819

Gene Stop:
664091

Gene Length:
729

Molecular Weight*:
28800

pI*:
9.60

Net Charge*:
6.36

EC:
3.1.21.4  

Functional Class:
Neisseria-specific protein  
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Primary Evidence:
Stein,D.C., Gunn,J.S., Radlinska,M. and Piekarowicz,A. Restriction and modification systems of Neisseria gonorrhoeae. Gene 157 (1-2), 19-22 (1995) Medline: 95331562.

Lau,P.C., Forghani,F., Labbe,D., Bergeron,H., Brousseau,R. and Holtke,H.J. The NlaIV restriction and modification genes of Neisseria lactamica are flanked by leucine biosynthesis genes. Mol. Gen. Genet. 243 (1), 24-31 (1994) Medline: 94247353.

Comment:
For other 'ngo'genes see NG1991 (ngoI), NG0676 (mngoV),NG1795 (NgoPII).


From GenBANK (gi:12644573): This protein recognizes the double-stranded sequence GGNNCC and cleaves after N-3.

See also the modification enzyme of this res/mod system, NG0676.

Oklahoma ID: NGO.675c

Blast Summary:  PSI-Blast Search
NG067s is 89% similar to a previously sequenced R.NgoV type II restriction endonuclease V of N.gonorrhoeae in GenBANK (12644573).

NG0676 is orthologous to U06074, N. lactamica restriction endonuclease NlaIV : residues 1-243 have 94% similarity to residues 1-243 in NG0676.
NG0676 is orthologous to AE002453, N. meningitidis MC58 type II restriction enzyme NlaIV : residues 1-243 have 93% similarity to residues 1-243 in NG0676.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-243 are 94% similar to a (TYPE II RESTRICTION ENZYME) protein domain (PD118879) which is seen in T2N4_NEILA.



Paralogs:  Local Blast Search


NG0675 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MIKLTAQQIFDKLLDEEKILSANGQIRFFLGDVDIIVKQKDVVGNIIQEW
LGGWLRKREIEFDVSTNTQMPPDFFLNKKDRSRELLEVKAFNRNACPGFD
IADFKMYSDEIIHKPYMLDVDYLIFGYDMDDNGNVTIKDLWLKKVWQITR
SMDGWAINLQVKKGVVHKIRPGVWYSINKKNMPMFECLEDFVSAIEETVY
QNPATRHNASLWKKKFEEAYKKHYNRSISIPRWHEIAHKYKKK

Gene Nucleotide Sequence:  Sequence Viewer
ATGATAAAACTTACTGCACAACAAATATTTGATAAGTTGCTGGATGAAGA
AAAAATCTTATCGGCCAATGGTCAAATTAGATTTTTCTTAGGAGATGTGG
ATATTATCGTCAAACAAAAAGATGTTGTCGGCAACATCATTCAGGAATGG
CTCGGCGGATGGTTGAGAAAAAGGGAAATTGAATTTGATGTTTCAACCAA
TACCCAAATGCCTCCCGATTTCTTTTTAAATAAAAAAGACCGCAGCAGAG
AATTGTTGGAAGTAAAGGCGTTCAACCGAAATGCCTGCCCGGGTTTTGAT
ATTGCAGATTTTAAAATGTATTCTGATGAAATCATTCATAAGCCCTATAT
GCTGGATGTAGATTATTTAATATTCGGTTACGATATGGACGACAACGGCA
ATGTAACCATCAAGGATTTATGGCTTAAAAAAGTATGGCAAATTACCAGA
AGCATGGATGGGTGGGCAATTAATCTTCAAGTCAAAAAAGGCGTGGTGCA
TAAAATCCGCCCGGGTGTTTGGTACAGCATAAATAAAAAGAATATGCCTA
TGTTTGAATGCTTGGAAGATTTTGTTTCCGCAATTGAAGAAACCGTTTAT
CAAAACCCGGCAACACGGCATAACGCATCCTTATGGAAAAAGAAATTTGA
GGAAGCTTATAAAAAACACTACAACCGATCGATTTCCATACCCCGTTGGC
ACGAAATTGCACACAAATACAAAAAGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy