Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0568 IGR0561 IGR0566 IGR0567 IGR0562 IGR0563 IGR0559 IGR0565 IGR0560 IGR0569 IGR0564 NG0667 NG0666 leuD, - NG0677 rngoV, - NG0675 spoU, - NG0670 NG0669 leu3, - NG0674 sun, - NG0668 mtb5,mngoV, - NG0676 NG0672 tpn, - NG0673 suhB, - NG0671 aldH, - NG0665 NG0667 NG0666 leuD, - NG0677 rngoV, - NG0675 spoU, - NG0670 NG0669 leu3, - NG0674 sun, - NG0668 mtb5,mngoV, - NG0676 NG0672 tpn, - NG0673 suhB, - NG0671 aldH, - NG0665 NG0666 leuD, - NG0677 rngoV, - NG0675 spoU, - NG0670 NG0669 leu3, - NG0674 sun, - NG0668 mtb5,mngoV, - NG0676 NG0667 tpn, - NG0673 suhB, - NG0671 aldH, - NG0665 NG0672
* Calculated from Protein Sequence

Gene ID: NG0671

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
suhB  

Definition:
extragenic suppressor protein (inositol monophosphatase)

Gene Start:
661212

Gene Stop:
661994

Gene Length:
783

Molecular Weight*:
28559

pI*:
6.20

Net Charge*:
-3.45

EC:
3.1.3.25  

Functional Class:
Central intermediary metabolism; Other  
Regulatory functions  

Pathway: pathway table
Inositol phosphate metabolism
Streptomycin biosynthesis

Secondary Evidence:
Yano,R., Nagai,H., Shiba,K. and Yura,T.
A mutation that enhances synthesis of sigma 32 and suppresses
temperature-sensitive growth of the rpoH15 mutant of Escherichia
coli
J. Bacteriol. 172 (4), 2124-2130 (1990)
Medline: 90202735

Matsuhisa A, Suzuki N, Noda T, Shiba K.
Inositol monophosphatase activity from the Escherichia coli suhB
gene product
J. Bacteriol. 177 (1), 200-205 (1995)
Medline: 95095968

Nigou J, Dover LG, Besra GS.
Purification and biochemical characterization of Mycobacterium tuberculosis SuhB, an inositol monophosphatase involved in inositol biosynthesis.
Biochemistry. 2002 Apr;41(13):4392-8.
PMID: 11914086

Chen L, Roberts MF.
Overexpression, purification, and analysis of complementation behavior of E. coli SuhB protein: comparison with bacterial and archaeal inositol monophosphatases.
Biochemistry. 2000 Apr;39(14):4145-53.
PMID: 10747806

Comment:
Oklahoma ID: NGO.671

Blast Summary:  PSI-Blast Search
Residues 1-261 are 98% similar to extragenic suppressor protein SuhB from Neisseria meningitidis group B strain MC58 (11278815|).

Numerous hits in gapped BLAST to extragenic suppressor protein SuhB sequences,e.g.residues 1-261 are 49% similar to extragenic suppressor protein SuhB from Pseudomonas aeruginosa strain PAO1 (11348507|).Residues 1-254 are 44% similar to extragenic suppressor protein SuhB from Escherichia coli K12 (2506780|).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0483
COG name: Inositol phosphatase family proteins
Functional Class:  G
The phylogenetic pattern of COG0483 is aMtkYqvCebRh----o---X
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000760 (Inositol monophosphatase) with a combined E-value of 4.7e-36.
    IPB000760A    38-68
    IPB000760B    81-92
    IPB000760C    211-229


ProDom Summary:  Protein Domain Search
Residues 40-247 are 44% similar to a (PROTEIN HYDROLASE INOSITOL) protein domain (PD000884) which is seen in SUHB_ECOLI.



Paralogs:  Local Blast Search


NG0671 is paralogously related to NG2161 (possible extragenic suppressor) (3e-25).


Pfam Summary:  Pfam Search
Residues 1 to 259 (E-value = 7.3e-75) place NG0671 in the Inositol_P family which is described as Inositol monophosphatase family (PF00459)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1AWB|1AWB-A HUMAN MYO-INOSITOL MONOPHOSPHATASE IN COMPLEX 141.0 2e-34
pdb|1IMA|1IMA-A INOSITOL MONOPHOSPHATASE (E.C.3.1.3.25) 141.0 2e-34
pdb|1LBV|1LBV-A CRYSTAL STRUCTURE OF APO-FORM (P21) OF DUAL 78.8 1e-15
pdb|1DK4|1DK4-A CRYS

Gene Protein Sequence:
MNPFLNTAFKAARRAGQMMIRAAGNLDAVKTDSKAFNDFVSDVDRNSEII
LVEALKEAYPHHKITCEESGFHGKATAEYEWIIDPLDGTTNFLHGHPQYA
ISMALLHKGVLQEALVYAPERNDVYMASRGKGALLNDRRIRVSNRIELNR
CLIGTGFPVVDQSMMDKYLAILKDFLAKTAGGRREGAASLDLCAVATGRF
DGFFEFNLKPWDIAAGALIVQEAGGIVTDMSGEDAWLESGDIVAANPKVL
AQMLKIISAHV

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATCCGTTTTTGAATACAGCCTTTAAAGCCGCCCGCCGTGCCGGTCA
GATGATGATTCGCGCCGCAGGTAACCTCGATGCCGTCAAAACCGACAGCA
AAGCCTTCAACGATTTTGTTTCCGATGTTGACCGCAATTCCGAAATCATC
CTGGTTGAGGCTTTGAAAGAAGCTTATCCGCATCACAAAATCACTTGCGA
AGAAAGCGGCTTCCACGGCAAAGCTACAGCCGAGTACGAATGGATTATCG
ATCCGCTCGACGGGACGACCAATTTCCTTCACGGCCATCCCCAATACGCC
ATCTCTATGGCACTGCTGCACAAAGGCGTGTTGCAGGAAGCTTTGGTGTA
CGCCCCCGAACGTAACGACGTGTACATGGCTTCGCGCGGTAAAGGCGCGT
TGCTTAACGACCGCCGCATCCGTGTCTCCAACCGCATCGAATTGAACCGC
TGCCTGATCGGTACCGGCTTCCCTGTTGTCGATCAAAGCATGATGGACAA
ATATCTGGCGATTTTGAAAGACTTTTTGGCAAAAACCGCCGGAGGCCGCC
GCGAAGGCGCGGCTTCTTTGGATTTGTGCGCCGTAGCAACAGGACGTTTT
GACGGCTTTTTCGAGTTCAACCTCAAACCGTGGGACATTGCCGCCGGTGC
ATTGATTGTCCAAGAAGCAGGCGGCATCGTTACCGATATGTCGGGTGAGG
ACGCTTGGTTGGAAAGCGGCGATATTGTGGCTGCCAATCCCAAAGTACTG
GCGCAAATGTTAAAAATCATTTCCGCACACGTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy