Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0558 IGR0561 IGR0568 IGR0566 IGR0567 IGR0562 IGR0563 IGR0559 IGR0565 IGR0560 IGR0564 NG0667 NG0666 rngoV, - NG0675 spoU, - NG0670 NG0669 leu3, - NG0674 sun, - NG0668 mtb5,mngoV, - NG0676 NG0672 NG0664 tpn, - NG0673 suhB, - NG0671 aldH, - NG0665 NG0667 NG0666 rngoV, - NG0675 spoU, - NG0670 NG0669 leu3, - NG0674 sun, - NG0668 mtb5,mngoV, - NG0676 NG0672 NG0664 tpn, - NG0673 suhB, - NG0671 aldH, - NG0665 NG0666 rngoV, - NG0675 spoU, - NG0670 NG0669 leu3, - NG0674 sun, - NG0668 mtb5,mngoV, - NG0676 NG0667 NG0664 tpn, - NG0673 suhB, - NG0671 aldH, - NG0665 NG0672
* Calculated from Protein Sequence

Gene ID: NG0670

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
spoU  

Definition:
tRNA/rRNA methylase family protein

Gene Start:
660968

Gene Stop:
660156

Gene Length:
813

Molecular Weight*:
30086

pI*:
6.00

Net Charge*:
-4.97

EC:
2.1.1.-  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  
Translation; Ribosomal proteins: synthesis and modification  

Pathway: pathway table
Aminophosphonate metabolism
Androgen and estrogen metabolism
Histidine metabolism
Porphyrin and chlorophyll metabolism
Selenoamino acid metabolism
Tryptophan metabolism
Tyrosine metabolism
Ubiquinone biosynthesis

Secondary Evidence:
Anantharaman V, Koonin EV, Aravind L.
SPOUT: a class of methyltransferases that includes spoU and trmD RNA methylase superfamilies, and novel superfamilies of predicted prokaryotic RNA methylases.
J Mol Microbiol Biotechnol. 2002 Jan;4(1):71-5.
PMID: 11763972

Persson BC, Jäger G, Gustafsson C.
The spoU gene of Escherichia coli, the fourth gene of the spoT operon, is essential for tRNA (Gm18) 2'-O-methyltransferase activity.
Nucleic Acids Res. 1997 Oct;25(20):4093-7.
PMID: 9321663

Koonin EV, Rudd KE.
SpoU protein of Escherichia coli belongs to a new family of putative rRNA methylases.
Nucleic Acids Res. 1993 Nov;21(23):5519.
PMID: 8265370

Comment:
Oklahoma ID: NGO.670c

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to RNA methyltransferases, probable ATP synthase beta subunits, and hypothetical proteins; e.g. residues 12-266 are 36% similar to AE000339, putative ATP synthase beta subunit of E. coli.

Residues 1-271 are 92% similar to AL162756, N. meningitidis Z2491 SpoU methylase family protein (11354159), and to AE002483, RNA methylase, putative, of Neisseria meningitidis MC58 (11278697).

COGS Summary:  COGS Search
BeTs to 5 clades of COG0565
COG name: rRNA methylase
Functional Class:  J
The phylogenetic pattern of COG0565 is amt----cE--h---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001537 (tRNA/rRNA methyltransferase (SpoU)) with a combined E-value of 2.1e-19.
    IPB001537A    17-41
    IPB001537B    142-150
    IPB001537C    173-186


ProDom Summary:  Protein Domain Search
Residues 15-187 are 43% similar to a (PROTEIN METHYLTRANSFERASE TRANSFERASE TRNA/RRNA RRNA) protein domain (PD001243) which is seen in O69217_AZOVI.



Paralogs:  Local Blast Search


NG0670 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 14 to 185 (E-value = 1.7e-16) place NG0670 in the SpoU_methylase family which is described as SpoU rRNA Methylase family (PF00588)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
42  
148

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MTALKPALPDYLGNIRIILTRTSHPANIGSAARAMKTMGLHRLTIVTPNL
MATPMTENPPVFNPDDVQSFALPEESFILASGAADVLHNAEIVATLDEAL
ADTTIACALTSRRREITAPLQTPRDLVPELLQAANRGEKVALVFGNETFG
LSIEEVRACNRLMTINGNPDYFSLNLAQAVQVVCYEIFSQTDSPMTHLQQ
EDHAATHEQIKGMLAHMESVMDDIGFFNRRNGERLMRRMQSLFGRANTQT
EDIDILRGFFNTVSHRIHKKD

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTGCTCTCAAACCCGCCCTGCCCGACTACCTCGGCAACATCCGCAT
CATCCTCACACGCACCAGCCACCCCGCCAACATCGGCTCTGCCGCACGCG
CGATGAAAACGATGGGTCTGCACAGGCTGACCATCGTCACCCCCAATCTG
ATGGCAACGCCGATGACGGAAAATCCGCCCGTTTTTAATCCCGATGACGT
GCAAAGTTTTGCACTGCCTGAAGAAAGTTTCATCCTCGCTTCCGGCGCGG
CGGACGTATTGCACAACGCCGAAATCGTCGCCACACTGGACGAAGCCCTT
GCCGACACCACCATCGCCTGCGCCCTGACCAGCCGCCGCCGCGAAATCAC
CGCGCCGCTGCAAACCCCGCGCGATTTGGTGCCCGAATTACTGCAGGCCG
CCAACCGCGGCGAGAAAGTGGCGCTGGTCTTCGGCAACGAGACTTTCGGC
TTGAGCATCGAAGAAGTCCGAGCGTGCAACCGACTGATGACCATCAACGG
CAACCCCGACTATTTCTCGCTCAACCTCGCCCAAGCCGTGCAGGTCGTGT
GCTACGAAATTTTCAGCCAAACCGATTCGCCCATGACCCATCTTCAACAG
GAAGACCACGCCGCAACCCACGAGCAAATCAAAGGCATGCTCGCCCACAT
GGAAAGCGTGATGGACGACATCGGCTTTTTCAACCGCCGCAACGGCGAGC
GTCTGATGCGCCGTATGCAGAGCCTGTTCGGACGCGCCAACACGCAAACC
GAAGACATCGACATCCTGCGCGGTTTTTTCAATACCGTCAGCCACCGTAT
CCATAAAAAAGAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy