Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0558 IGR0561 IGR0562 IGR0563 IGR0555 IGR0559 IGR0556 IGR0560 IGR0557 IGR0564 NG0667 gatC, - NG0663 NG0666 spoU, - NG0670 NG0669 lapB,ybjX, - NG0661 sun, - NG0668 gatB, - NG0660 gatA, - NG0662 NG0664 suhB, - NG0671 aldH, - NG0665 NG0667 gatC, - NG0663 NG0666 spoU, - NG0670 NG0669 lapB,ybjX, - NG0661 sun, - NG0668 gatB, - NG0660 gatA, - NG0662 NG0664 suhB, - NG0671 aldH, - NG0665 gatC, - NG0663 NG0666 spoU, - NG0670 NG0669 lapB,ybjX, - NG0661 sun, - NG0668 gatB, - NG0660 gatA, - NG0662 NG0667 NG0664 suhB, - NG0671 aldH, - NG0665
* Calculated from Protein Sequence

Gene ID: NG0665

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aldH  

Definition:
aldehyde dehydrogenase

Gene Start:
655785

Gene Stop:
657125

Gene Length:
1341

Molecular Weight*:
49366

pI*:
6.70

Net Charge*:
-1.88

EC:
1.2.1.-  1.2.1.19  1.2.1.3  

Functional Class:
Unassigned  

Pathway: pathway table
1,2-Dichloroethane degradation
Arginine and proline metabolism
Ascorbate and aldarate metabolism
beta-Alanine metabolism
Bile acid biosynthesis
Butanoate metabolism
Fatty acid metabolism
Glycerolipid metabolism
Histidine metabolism
Lysine degradation
Phenylalanine metabolism
Porphyrin and chlorophyll metabolism
Propanoate metabolism
Pyruvate metabolism
Tryptophan metabolism
Valine, leucine and isoleucine degradation

Comment:
Oklahoma ID: NGO.665

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to aldehyde dehydrogenase family proteins; e.g. residues 4-446 are 42% similar to aldehyde dehydrogenase-like protein of E. coli (3915524).

Residues 1-447 have 97% similarity to AE002483, Neisseria meningitidis MC58 aldehyde dehydrogenase family protein (11251939), and 96% similarity to AL162756, putative aldehyde dehydrogenase, of N.meningitidis Z2491 (11251931).

COGS Summary:  COGS Search
BeTs to 9 clades of COG1012
COG name: NAD-dependent aldehyde dehydrogenases
Functional Class:  C
The phylogenetic pattern of COG1012 is -mt-Yq-CEBR-uj-------
Number of proteins in this genome belonging to this COG is 4

Blocks Summary:  Blocks Search
***** IPB002086 (Aldehyde dehydrogenase family) with a combined E-value of 5e-70.
    IPB002086A    119-132
    IPB002086B    143-160
    IPB002086C    192-212
    IPB002086D    226-269
    IPB002086E    333-386
    IPB002086F    407-431


ProDom Summary:  Protein Domain Search
Residues 122-172 are 49% similar to a (DEHYDROGENASE OXIDOREDUCTASE ALDEHYDE NAD PROTEIN ALDH) protein domain (PD000219) which is seen in O69497_MYCLE.

Residues 367-446 are 56% similar to a (DEHYDROGENASE OXIDOREDUCTASE ALDEHYDE NAD PROTEIN ALDH) protein domain (PD000187) which is seen in YNEI_ECOLI.

Residues 296-354 are 47% similar to a (DEHYDROGENASE OXIDOREDUCTASE ALDEHYDE NAD PROTEIN ALDH) protein domain (PD000263) which is seen in YNEI_ECOLI.

Residues 195-294 are 45% similar to a (DEHYDROGENASE OXIDOREDUCTASE ALDEHYDE NAD PROTEIN ALDH) protein domain (PD000218) which is seen in O06478_BACSU.



Paralogs:  Local Blast Search


NG0665 is paralogously related to NG1061 (succinate semialdehyde dehydrogenase) (9e-65), NG2114 (aldehyde dehydrogenase) (9e-46) and NG1554 (proline dehydrogenase) (7e-29).


Pfam Summary:  Pfam Search
Residues 1 to 444 (E-value = 8.7e-96) place NG0665 in the Aldedh family which is described as Aldehyde dehydrogenase family (PF00171)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
103

PDB Hit:
pdb|1BI9|1BI9-A RETINAL DEHYDROGENASE TYPE TWO WITH NAD BOUND 213.0 4e-56
pdb|1CW3|1CW3-A HUMAN MITOCHONDRIAL ALDEHYDE DEHYDROGENASE 207.0 4e-54
pdb|1A4Z|1A4Z-A ALDEHYDE DEHYDROGENASE FROM BOVINE MITOCHONDRIA 202.0 9e-53
pdb|1BXS|1BXS-A SHEE

Gene Protein Sequence:
MFHSVNVFTGETLYRRPDQDYAEFERRLADLKMHGRAFAQLGVTERAARL
QKFAGRLEAEKERFAEMVCEEVGRCLHECRAEIVKSIELIRYYARLAPEL
LAHKTIATQASLSQVRFEPLGVVFAVMPWNYPVWQVLRFAVPAMCAGNAC
AVKPAPSVARVSRALFDLASDGIPLAGAWLDEADTLKAVEDTDAMAFTGS
THTGRILAAHAGANLKKTVLELGGSNAFIVMPDADLERAAAEACYSRFRD
AGQSCNAAKRIIVTEAAADRFIQLFLAECAKLKMGDPKHPDTTLAPLHRE
DLRDRVHGQVEDAVSNGAVCLTGGKVPQGSGWFYPATVLDRVNPACRVWR
EEVFGPVALILRAENEEHAICLANDSPFGLGACIYTADTERAWRFAEKIQ
AGSVFINRHTSSDLRLPFGGVKDSGYGRELSEFGLYEFVNVKTYWQK

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTCACAGTGTCAATGTATTTACGGGCGAAACGCTTTACCGCCGCCC
CGATCAAGATTATGCGGAGTTTGAACGGCGGCTGGCGGATTTGAAAATGC
ACGGCAGGGCGTTCGCGCAATTGGGCGTAACCGAACGTGCCGCGCGTCTG
CAAAAATTTGCCGGCCGTTTGGAGGCGGAAAAAGAGCGTTTTGCGGAAAT
GGTGTGCGAAGAAGTCGGACGCTGCCTGCACGAATGCCGTGCCGAAATCG
TCAAGTCTATCGAACTGATACGCTATTACGCCCGCCTTGCCCCCGAACTG
CTTGCCCACAAAACCATTGCGACGCAGGCGAGTTTGAGTCAGGTGCGCTT
CGAGCCTTTGGGCGTGGTGTTTGCCGTCATGCCTTGGAACTATCCCGTCT
GGCAGGTATTGCGTTTCGCCGTTCCCGCTATGTGCGCGGGCAACGCGTGC
GCCGTCAAACCCGCGCCCAGCGTGGCACGCGTCAGTCGGGCGTTGTTCGA
TTTGGCTTCAGACGGTATTCCTCTGGCAGGCGCGTGGCTGGATGAGGCGG
ACACGCTCAAGGCAGTCGAAGATACCGATGCGATGGCGTTTACCGGTTCG
ACGCATACGGGGCGCATTCTTGCGGCACATGCGGGCGCAAACCTCAAGAA
AACCGTGTTGGAGCTCGGCGGCAGCAACGCCTTTATCGTGATGCCCGATG
CCGATTTGGAACGCGCCGCCGCAGAAGCCTGTTATTCCCGTTTCCGCGAT
GCGGGGCAATCGTGTAACGCCGCCAAGCGCATCATCGTAACCGAAGCCGC
AGCCGACCGCTTTATTCAGCTGTTTCTCGCCGAATGCGCCAAATTGAAAA
TGGGAGACCCGAAACATCCCGATACCACGCTTGCACCGCTGCACCGCGAA
GATTTGCGGGACCGGGTTCACGGGCAGGTTGAAGATGCCGTTTCAAACGG
CGCGGTGTGCCTGACCGGAGGCAAAGTTCCACAGGGGTCGGGGTGGTTTT
ACCCTGCGACGGTTTTAGACAGGGTAAATCCTGCCTGCCGCGTCTGGAGA
GAAGAAGTATTCGGCCCCGTCGCCCTGATTTTGCGCGCCGAAAACGAAGA
ACACGCCATCTGCCTTGCCAATGATTCCCCGTTCGGGCTCGGTGCCTGCA
TTTATACCGCCGATACTGAACGCGCCTGGCGGTTTGCCGAAAAAATACAG
GCCGGATCGGTGTTTATCAACCGCCATACCAGCAGCGATTTGCGCCTGCC
TTTCGGCGGAGTCAAAGATTCCGGTTACGGGCGCGAACTGTCCGAATTCG
GGTTGTACGAGTTCGTCAACGTCAAAACCTACTGGCAGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy