Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0546 IGR0551 IGR0548 IGR0553 IGR0549 IGR0545 IGR0552 IGR0547 IGR0550 trx1, - NG0652 nadE,outB, - NG0654 ascD, - NG0659 NG0657 rhlE, - NG0650 NG0653 pdxH, - NG0658 NG0651 xseA,ex7L, - NG0655 oxlT, - NG0656 trx1, - NG0652 nadE,outB, - NG0654 ascD, - NG0659 NG0657 rhlE, - NG0650 NG0653 pdxH, - NG0658 NG0651 xseA,ex7L, - NG0655 oxlT, - NG0656 Type: tandem, Name:  - 33 trx1, - NG0652 nadE,outB, - NG0654 ascD, - NG0659 NG0657 rhlE, - NG0650 NG0653 pdxH, - NG0658 NG0651 xseA,ex7L, - NG0655 oxlT, - NG0656
* Calculated from Protein Sequence

Gene ID: NG0655

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
xseA  ex7L  

Definition:
exonuclease VII large subunit

Gene Start:
644186

Gene Stop:
645538

Gene Length:
1353

Molecular Weight*:
49786

pI*:
9.80

Net Charge*:
12.34

EC:
3.1.11.6  

Functional Class:
Replication; Degradation of DNA  

Pathway: pathway table

Secondary Evidence:
Chase,J.W., Rabin,B.A., Murphy,J.B., Stone,K.L. and Williams,K.R. Escherichia coli exonuclease VII. Cloning and sequencing of the gene encoding the large subunit (xseA).
J. Biol. Chem. 261 (32): 14929-14935 (1986)
[Medline: 87033720].

Vales,L.D., Rabin,B.A. and Chase,J.W.
Subunit structure of Escherichia coli exonuclease VII .
J. Biol. Chem. 257 (15): 8799-8805 (1982)
[Medline: 82239360].

Comment:
From GenBANK (gi:14194729): Exonuclease VII bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. Its catalytic activity is exonucleolytic cleavage in either 5'-to 3'-or 3'-to 5'-direction to yield 5'-phosphomononucleotides. The complex is a heterooligomer composed of large and small subunits (by similarity).

See also the small subunit, NG1734.

Oklahoma ID: NGO.655

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to exodeoxyribonuclease VII, large subunit; e.g. residues 2-433 are 41% similar to AE004162 of Vibrio cholerae.

Residues 1-451 are 95% similar to NMA1575, and are 93% similar to NMB1363, both exonuclease VII large subunits of N.meningitidis (11263338, 11263340).

COGS Summary:  COGS Search
BeTs to 7 clades of COG1570
COG name: Exonuclease VII, large subunit
Functional Class:  L
The phylogenetic pattern of COG1570 is ------v-ebrhUj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003753 (Exonuclease VII, large subunit) with a combined E-value of 4.4e-107.
    IPB003753A    29-64
    IPB003753B    65-98
    IPB003753C    114-152
    IPB003753D    188-220
    IPB003753E    221-261
    IPB003753F    269-319
    IPB003753G    361-405


ProDom Summary:  Protein Domain Search
Residues 229-307 are 50% similar to a (EXONUCLEASE LARGE SUBUNIT VII) protein domain (PD010734) which is seen in EX7L_HAEIN.

Residues 309-432 are 27% similar to a (EXODEOXYRIBONUCLEASE LARGE SUBUNIT) protein domain (PD020865) which is seen in EX7L_ECOLI.

Residues 9-225 are 51% similar to a (LARGE SUBUNIT EXONUCLEASE VII) protein domain (PD013688) which is seen in EX7L_ECOLI.



Paralogs:  Local Blast Search


NG0655 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 30 to 105 (E-value = 8.3e-13) place NG0655 in the tRNA_anti family which is described as OB-fold nucleic acid binding domain (PF01336)
Residues 198 to 390 (E-value = 4.4e-43) place NG0655 in the Exonuc_VII_L family which is described as Exonuclease VII, large subunit (PF02601)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
104  
131
transmembrane  
141  
157
non-globular  
330  
421

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MSDFFHSDVLSVSELNAFAKSILENHLAGLWIAGEVSNLTRAASGHYYFS
LKDSRAQVRCAMFKGAAARLAQPLKEGDHIEVAGKISIYEARGEFQITVN
EVRLKGLGQLYEAYERLKAQLQAEGAFAAERKKPLPVRPQCIGIVTSLAA
AALRDVVTTLKRRAPEIPVIVYPAAVQGAGSGFQIAQAIKTASQRAECDV
LIVCRGGGSIEDLRAFNEEPVVRAIEACTIPVVSGVGHETDFTLADFVAD
VRAPTPTGAAELVSPNRQESLHRLVQAQGRLKTVLEQRYFDASQKLDWLA
RQIRHPRQKLDEQRASIGKLAQTLSYSMTQNLRAHTARFERQTQALQHCR
PDVSVYRQDIVRLQTALPAAFSRLLARRRQSLTAQAALLEAVSPQHILER
GFSVVKNTRGQVIRNADVLKQGQKLHITFSDGETDVRVSKEQGQQDLFDC
I

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTGATTTTTTTCATTCTGACGTGTTGTCCGTTTCCGAGTTGAACGC
ATTTGCCAAAAGTATTTTGGAAAACCACCTTGCCGGCCTGTGGATTGCGG
GCGAAGTGTCCAATCTGACCCGCGCCGCCAGCGGGCATTATTATTTCTCA
CTCAAAGACAGCCGCGCGCAGGTGCGTTGCGCGATGTTCAAGGGTGCGGC
GGCGCGTTTGGCGCAACCTTTGAAAGAAGGCGACCATATCGAAGTGGCGG
GCAAAATCAGTATTTACGAGGCGCGGGGCGAATTTCAGATTACCGTAAAC
GAAGTACGGCTCAAAGGTTTGGGGCAGCTTTACGAAGCCTACGAGCGGTT
GAAGGCGCAGTTGCAGGCGGAAGGCGCGTTTGCGGCGGAACGCAAAAAAC
CTTTGCCCGTCCGTCCGCAATGTATCGGCATCGTTACCAGTCTGGCGGCG
GCGGCTTTGCGCGATGTCGTAACCACCTTGAAACGCCGCGCGCCCGAAAT
CCCCGTCATCGTTTATCCGGCCGCCGTTCAGGGCGCGGGCAGCGGGTTTC
AGATTGCCCAAGCGATTAAAACCGCATCGCAACGCGCCGAATGCGATGTG
CTGATTGTCTGTCGCGGCGGCGGCAGCATCGAAGACTTGCGGGCGTTTAA
CGAAGAACCGGTCGTGCGCGCCATCGAAGCCTGCACGATTCCCGTCGTCA
GCGGCGTGGGACACGAAACCGATTTCACGCTCGCCGATTTCGTTGCCGAC
GTGCGCGCGCCCACGCCGACCGGCGCGGCGGAACTGGTCAGCCCCAACCG
CCAAGAATCACTGCACCGCCTCGTCCAAGCCCAAGGCCGTCTGAAAACCG
TTTTGGAGCAACGCTATTTCGATGCCAGCCAAAAACTCGACTGGCTCGCG
CGGCAAATCCGCCACCCGCGCCAAAAACTTGACGAGCAGCGCGCTTCAAT
CGGCAAGCTGGCGCAAACGCTGTCTTACTCGATGACGCAAAACCTCCGCG
CCCACACCGCCCGTTTTGAACGCCAAACCCAAGCCCTGCAACATTGCCGT
CCTGATGTTTCCGTTTACCGGCAAGATATCGTCCGCCTTCAGACGGCATT
GCCCGCCGCCTTCAGCCGGCTGCTCGCCCGTCGCCGTCAAAGCCTGACCG
CCCAAGCCGCATTGCTCGAAGCCGTTTCGCCGCAGCACATTCTGGAACGC
GGCTTCTCCGTTGTCAAAAATACACGCGGACAAGTCATCCGTAACGCTGA
TGTTTTGAAGCAGGGGCAGAAGCTGCACATTACCTTCTCCGACGGCGAAA
CCGACGTGCGCGTAAGCAAAGAACAAGGGCAGCAGGATTTGTTCGATTGC
ATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy