Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0533 IGR0534 IGR0538 IGR0535 IGR0536 IGR0537 NG0635 NG0637 NG0643 truB, - NG0642 iscS,nifS, - NG0636 res, - NG0640 NG0638 lldD, - NG0639 NG0635 NG0637 NG0643 truB, - NG0642 iscS,nifS, - NG0636 res, - NG0640 NG0638 lldD, - NG0639 Type: tandem, Name:  - 31 NG0635 NG0637 truB, - NG0642 iscS,nifS, - NG0636 res, - NG0640 mod, - NG0641 mod, - NG0641 NG0643 NG0638 lldD, - NG0639
* Calculated from Protein Sequence

Gene ID: NG0640

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
res  

Definition:
type III restriction/modification system enzyme

Gene Start:
630083

Gene Stop:
627312

Gene Length:
2772

Molecular Weight*:
107414

pI*:
6.30

Net Charge*:
-9.14

EC:
2.1.1.72  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Su,P., Im,H., Hsieh,H., Kang'A,S. and Dunn,N.W. LlaFI, a type III restriction and modification system in Lactococcus lactis. Appl. Environ. Microbiol. 65 (2), 686-693 (1999) Medline: 99124607.

Comment:
For other 'res' genes see NG0102 (resB),NG0103(resC),NG0176
(resE),NG0546 (res),NG2124 (resA).


From GenBANK (gi:1175414): This enzyme contains two subunits, RES and MOD (See NG0641). See also another res/mod system: NG0546, subunit RES of type III site-specific deoxyribonuclease, and NG0545, subunit MOD.

From Medline (99124607): A type III restriction and modification (R/M) system, LlaFI, in Lactococcus lactis consists of two adjacent open reading frames (ORFs). The two ORFs exhibited significant similarity to type III restriction (Res) and modification (Mod) subunits. The seven conserved helicase motifs found in the previously described type III R/M systems were found at the same relative positions in the LlaFI Res sequence. LlaFI has cofactor requirements for activity that are characteristic of the previously described type III enzymes. ATP and Mg2+ are required for endonucleolytic activity; however, the activity is not strictly dependent on the presence of Ado-Met but is stimulated by it. This type III R/M system has been characterized not just in lactic acid bacteria but also in gram-positive bacteria.

Oklahoma ID: NGO.640c

Blast Summary:  PSI-Blast Search
Several significant hits in gapped BLAST to type III restriction/modification system enzymes; e.g. residues 1-484 are 93% similar to U32786, putative type III restriction-modification system HINDVIP enzyme RES, of H. influenzae.

Residues 1-924 are 93% similar to NMA1591, a type III restriction/modification system enzyme, and AF048762, a hypothetical membrane lipoprotein, both of N.meningitidis (11354117, 4105609). Also 92% similar to restriction modification system-R protein (3928003).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-74 are 93% similar to a (PROTEIN LIPOPROTEIN NPP47 MEMBRANE HI1055) protein domain (PD156401) which is seen in YA55_HAEIN.



Paralogs:  Local Blast Search


NG0640 is paralogously related to NG0546 (type III restriction-modification system EcoPI enzyme (type III site-specific deoxyribonuclease, subunit res)) (2e-05).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
413  
440
coil-coil  
674  
707

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MANNKTLFDWVEDRKSMLEEMEQTDFFALPEFVSNNLKYPFFEWQKSALE
NFVIFDRTSKLKDFPDIKNRPTHLLFNMATGAGKTMMIAALILYYFEKGY
RHFLFFVNKNNIVYKTENNFIDPTHPKFLFTEKILQGDTVIPIRKVETFS
QYSDGIEIKFTSIQKLYNDIHTERENQTTLADLHELNLVILGDEAHHLNA
QTKGKKQGELDLEKEMNERTSDAEIERKGWEHMVLELLLNKNGNPGQNVL
LEFTATLPENAEVQQKYADKIITKFGLKEFLQKGYTKEINLVSGTLNKKE
RVLHALLFAWYRHQIALKYGIANFKPVMLFRSKTIDESKADYSAFLNWVE
NVQADDFSFLTTFSTSLSDSNNANEQGKTRTEQALKFMQENKFEFVHLAN
WVKQNYQKHNVIITNSETNKTKTEKTDSETEKLLNNLEAADNPIRAIFTV
DRLTEGWDVLNLFDIVRLYEGQNGGGSNKKSGKTAAATVSEKQLIGRGVR
YFPFAFEGKQPNKRKFDNDMQHELRILEELFYYTHDEQSRYITELKNELR
KDGYLPEKDDDKVLTTFKLKSEFADNKDFRELLIWANKKIPNPNAKSNNA
DSLQANPQTLSFQVHGNQLLQETQFTADENDETARQIGTQNNFTQTIKMS
EMERHIFNKALHIKGKNSQSLFHFDRLQSKLDIQNRNELQNKLLKDWQIE
FLGLEQDKQVRPDDKLAGCLKILEMVEKHLNESDIPFIGTKEFTPKKLWE
IFGTPKQKWVKKDDIKTAIATQNDWYVMDNFAGTGLEEALIQFISARLGD
LKSQYDVHLIRNEEVFKLNNFADGEGFMPDFVLLLKDKQKSSSDSVDDFL
HYQIFIEPKGGHLVENDSWKEAFLKSITVEYGRDKILQKNTPHYRLIGLP
FFTDHQKNGQFTELFPLGAASLEK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGAATAATAAAACGTTGTTTGATTGGGTGGAAGACCGCAAATCAAT
GCTGGAAGAAATGGAACAGACGGATTTTTTCGCGCTGCCTGAATTTGTTT
CCAATAATTTAAAATATCCGTTTTTTGAATGGCAAAAATCGGCTTTAGAA
AATTTTGTGATTTTTGACCGCACTTCAAAATTAAAGGATTTCCCCGACAT
CAAAAACCGCCCTACCCATTTGCTGTTCAATATGGCAACAGGTGCAGGCA
AAACGATGATGATAGCGGCATTGATTCTGTATTATTTTGAGAAAGGGTAT
CGGCATTTTTTATTTTTCGTCAATAAAAACAATATAGTATATAAAACGGA
AAATAATTTTATCGACCCGACGCATCCAAAATTTTTATTTACCGAGAAAA
TTTTGCAAGGTGATACGGTAATTCCCATTCGCAAAGTGGAGACATTTAGC
CAATATTCAGACGGCATTGAAATTAAATTTACCAGCATTCAAAAACTATA
TAACGATATTCACACCGAGCGAGAAAATCAAACCACATTGGCGGATTTGC
ACGAATTAAATCTTGTGATTCTGGGCGATGAAGCACACCATTTAAACGCG
CAAACCAAAGGCAAAAAACAAGGCGAATTAGATTTAGAAAAGGAAATGAA
CGAGCGTACCAGCGATGCCGAAATTGAACGCAAAGGCTGGGAGCATATGG
TTTTGGAGTTGTTACTCAATAAAAATGGCAATCCCGGCCAAAATGTGCTG
TTGGAATTTACCGCCACACTGCCTGAAAATGCTGAAGTGCAACAAAAATA
TGCGGATAAAATCATCACAAAATTTGGGTTAAAAGAATTTTTGCAAAAAG
GTTATACCAAAGAAATCAATTTGGTATCCGGTACGCTGAATAAGAAAGAG
CGGGTGTTGCACGCTTTATTGTTTGCCTGGTACCGCCATCAAATCGCGTT
GAAATACGGCATTGCCAATTTCAAGCCTGTGATGTTGTTTAGAAGTAAGA
CGATTGATGAATCAAAAGCGGATTATTCGGCGTTTTTAAATTGGGTAGAA
AATGTGCAAGCGGATGATTTTTCGTTTTTAACTACATTTTCAACAAGCTT
AAGCGATAGCAATAACGCCAACGAACAAGGCAAAACCCGTACCGAACAAG
CCCTAAAATTTATGCAGGAAAATAAATTTGAGTTTGTGCATTTGGCAAAT
TGGGTGAAACAAAATTATCAAAAACATAATGTCATTATTACCAACTCCGA
AACCAACAAAACCAAAACTGAAAAAACCGACAGCGAAACCGAAAAATTGC
TAAACAATTTGGAAGCGGCTGATAATCCGATCCGTGCCATTTTTACGGTG
GATAGATTAACCGAAGGTTGGGACGTTTTAAATTTGTTTGATATTGTGCG
TTTGTATGAAGGGCAAAACGGTGGCGGTTCGAATAAAAAATCGGGCAAAA
CGGCTGCCGCCACCGTATCGGAAAAGCAGTTGATTGGTCGCGGCGTGCGT
TATTTTCCATTTGCGTTTGAAGGTAAACAGCCGAATAAACGCAAATTTGA
CAACGATATGCAACATGAATTGCGTATCTTGGAAGAATTGTTTTATTACA
CGCACGATGAGCAATCCCGCTATATTACAGAACTGAAAAACGAGTTACGA
AAAGACGGTTATTTGCCTGAAAAAGACGATGATAAGGTATTGACAACATT
TAAGCTCAAATCTGAATTTGCAGATAATAAGGATTTTAGAGAGTTGTTAA
TTTGGGCGAATAAAAAAATCCCCAACCCAAACGCCAAAAGCAATAATGCA
GACAGCCTGCAAGCCAATCCGCAAACGCTTTCATTCCAAGTTCACGGTAA
TCAACTGTTGCAGGAAACGCAATTTACAGCCGATGAAAATGATGAAACAG
CCCGACAAATCGGCACACAAAATAATTTTACTCAAACCATAAAAATGAGT
GAAATGGAGCGGCATATTTTCAATAAAGCATTACATATCAAAGGGAAAAA
TAGTCAATCTTTATTCCATTTTGACCGCCTGCAAAGCAAACTCGACATTC
AAAATCGCAATGAATTGCAAAATAAATTGTTGAAAGACTGGCAGATTGAA
TTTTTGGGATTAGAGCAAGATAAACAGGTTCGCCCGGATGATAAACTTGC
AGGCTGCCTGAAAATCTTGGAAATGGTTGAAAAACATCTGAATGAAAGTG
ATATACCGTTTATCGGTACAAAAGAATTTACACCTAAAAAATTGTGGGAA
ATTTTCGGCACGCCAAAACAAAAATGGGTCAAAAAAGATGATATAAAAAC
TGCTATTGCCACGCAAAATGATTGGTATGTGATGGATAATTTTGCCGGAA
CGGGTTTGGAAGAAGCGTTAATTCAATTTATTTCAGCGCGCTTGGGCGAT
TTGAAATCTCAATATGACGTTCATTTAATCCGCAATGAAGAAGTGTTTAA
ATTGAATAACTTTGCCGATGGCGAAGGATTTATGCCGGACTTTGTTTTAT
TGCTGAAAGATAAACAAAAATCTTCTTCCGACAGCGTGGACGACTTTTTG
CATTACCAAATTTTCATTGAACCGAAAGGCGGGCATTTAGTGGAAAATGA
TTCGTGGAAAGAAGCTTTTTTAAAATCAATCACAGTGGAATATGGGAGGG
ATAAGATCCTGCAAAAAAATACACCGCATTATCGTTTGATCGGTTTGCCG
TTTTTTACTGATCATCAGAAAAATGGACAATTTACAGAGTTATTCCCTTT
AGGTGCGGCATCGCTTGAAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy