Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0533 IGR0531 IGR0534 IGR0528 IGR0530 IGR0535 IGR0536 IGR0532 IGR0529 NG0635 hesB, - NG0632 hscB, - NG0630 nifU, - NG0633 NG0637 iscS,nifS, - NG0636 res, - NG0640 NG0631 NG0638 NG0634 lldD, - NG0639 NG0635 hesB, - NG0632 hscB, - NG0630 nifU, - NG0633 NG0637 iscS,nifS, - NG0636 res, - NG0640 NG0631 NG0638 NG0634 lldD, - NG0639 NG0635 hesB, - NG0632 hscB, - NG0630 nifU, - NG0633 NG0637 iscS,nifS, - NG0636 res, - NG0640 mod, - NG0641 mod, - NG0641 NG0631 NG0638 NG0634 lldD, - NG0639
* Calculated from Protein Sequence

Gene ID: NG0639

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lldD  

Definition:
L-lactate dehydrogenase

Gene Start:
625988

Gene Stop:
627157

Gene Length:
1170

Molecular Weight*:
43386

pI*:
7.10

Net Charge*:
0.28

EC:
1.1.2.3  

Functional Class:
Energy metabolism; Aerobic respiration  

Pathway: pathway table
Pyruvate metabolism

Secondary Evidence:
Dong,J.M., Taylor,J.S., Latour,D.J., Iuchi,S. and Lin,E.C. Three overlapping lct genes involved in L-lactate utilization by Escherichia coli. J. Bacteriol. 175 (20): 6671-6678 (1993) [Medline: 94012541].

Comment:
From GenBANK (gi:462488): Catalytic activity: (S)-lactate + 2 ferricytochrome C = pyruvate + 2 ferrocytochrome C, requiring a cofactor, FMN. Induced aerobically by l-lactate. Belongs to the FMN-dependent alpha-hydroxy acid dehydrogenases family.

Oklahoma ID: NGO.639

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to L-lactate dehydrogenases; e.g. residues 3-380 are 79% similar to AE006064 of Pasteurella multocida.

Residues 1-390 are 98% similar to NMA1592 and AE002486, both L-lactate dehydrogenase of N.meningitidis (11251817, 1381737).


COGS Summary:  COGS Search
BeTs to 7 clades of COG1304
COG name: L-lactate dehydrogenase (FMN-dependent) and related alpha-hydroxy acid dehydrogenases
Functional Class:  C
The phylogenetic pattern of COG1304 is Amtky--cebRh----ol--x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000262 (FMN-dependent alpha-hydroxy acid dehydrogenases) with a combined E-value of 1.1e-173.
    IPB000262A    22-70
    IPB000262B    71-118
    IPB000262C    130-175
    IPB000262D    234-262
    IPB000262E    263-299
    IPB000262F    304-356


ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG0639 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 18 to 382 (E-value = 1.6e-235) place NG0639 in the FMN_dh family which is described as FMN-dependent dehydrogenase (PF01070)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1GOX|1GOX GLYCOLATE OXIDASE (E.C.1.1.3.1) 250.0 3e-67
pdb|1AL7|1AL7 THREE-DIMENSIONAL STRUCTURES OF GLYCOLATE OXIDASE250.0 3e-67
pdb|1GYL|1GYL-A GLYCOLATE OXIDASE (E.C.1.1.3.15) MUTANT WITH TYR249.0 9e-67
pdb|1HUV|1HUV-A CRYS

Gene Protein Sequence:
MKRDLSKMTCIEDLHRVAKRKMPRMFYDYIDSGSWTETTYRENTSDFKDI
RFRQKVLVNMEGRSLETKMIGGDVKMPVAIAPTGFTGMAHADGEILAARA
AEKFGIPFTLSTMSICSIEDVAENTSAPFWFQLYVMRDREFMENLIKRAK
DAKCSALVLTADLQVLGQRHKDIKNGLSAPPKPTIANLINLATKPEWCMK
MLNTERRTFRNIVGHAKNVGDLSSLSSWTAEQFDPRLSWDDVARIKDLWG
GKLIIKGIMEPEDAEKAAKSGADALVVSNHGGRQLDDTVSAIKALPDIVS
AVGSDIEVWMDSGIRSGQDILKAWALGAKGTMIGRAFLYGLGAYGEEGVT
RALEILYKEMDVSMAFTGHRDIQDVDASILRSKDWGRETV

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACGTGATTTGAGCAAAATGACCTGCATTGAAGACTTGCACCGCGT
TGCCAAGCGCAAAATGCCGCGTATGTTTTACGATTACATCGATTCGGGTT
CGTGGACGGAAACGACTTATAGGGAGAATACTTCGGATTTCAAAGATATC
CGCTTCCGACAAAAGGTATTGGTCAATATGGAGGGACGCAGCCTCGAAAC
CAAAATGATCGGGGGGGATGTGAAAATGCCGGTGGCGATTGCGCCGACGG
GTTTTACCGGCATGGCACACGCAGACGGCGAAATTTTGGCGGCGCGTGCG
GCGGAGAAGTTCGGTATTCCGTTTACGTTGTCCACCATGTCCATCTGCTC
GATTGAAGACGTTGCCGAGAACACCAGCGCGCCGTTTTGGTTTCAGCTTT
ATGTGATGCGCGACCGCGAATTTATGGAAAACCTGATTAAGCGTGCGAAA
GATGCCAAATGTTCGGCATTGGTATTGACTGCCGATTTGCAGGTTTTGGG
TCAACGCCACAAAGACATCAAAAACGGCCTGTCCGCGCCGCCGAAACCGA
CCATCGCCAATTTAATCAATCTGGCGACCAAGCCCGAATGGTGCATGAAA
ATGCTGAACACGGAACGCCGCACGTTCCGCAATATCGTCGGACACGCCAA
AAACGTCGGCGATTTGTCTTCACTTTCTTCGTGGACGGCGGAACAGTTCG
ACCCGCGCTTAAGCTGGGACGACGTGGCGCGGATTAAAGATTTGTGGGGC
GGCAAGCTGATTATCAAAGGCATTATGGAACCCGAAGACGCGGAAAAGGC
GGCGAAAAGCGGTGCGGATGCATTGGTCGTTTCCAACCACGGCGGCCGCC
AGCTCGACGATACTGTGTCCGCCATCAAGGCCTTGCCCGATATTGTTTCC
GCAGTCGGCAGCGACATCGAAGTTTGGATGGACAGCGGTATCCGCAGCGG
TCAGGATATTTTGAAGGCGTGGGCTTTGGGTGCGAAAGGCACGATGATAG
GTCGGGCGTTCCTGTATGGTTTGGGTGCGTATGGCGAAGAAGGCGTAACG
CGCGCGCTGGAGATTTTGTACAAGGAAATGGATGTGTCGATGGCGTTTAC
GGGACACCGCGATATTCAAGATGTCGATGCCTCGATTTTGAGGAGTAAGG
ATTGGGGCAGGGAAACGGTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy