Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0533 IGR0531 IGR0528 IGR0530 IGR0527 IGR0524 IGR0532 IGR0529 IGR0525 IGR0526 NG0635 hesB, - NG0632 hscB, - NG0630 nifU, - NG0633 iscS,nifS, - NG0636 gcr, - NG0627 gyrA, - NG0629 NG0631 NG0634 tpn, - NG0628 mltB, - NG0626 NG0635 hesB, - NG0632 hscB, - NG0630 nifU, - NG0633 iscS,nifS, - NG0636 gcr, - NG0627 gyrA, - NG0629 NG0631 NG0634 tpn, - NG0628 mltB, - NG0626 Type: direct, Name:  - 133 NG0635 hesB, - NG0632 hscB, - NG0630 nifU, - NG0633 iscS,nifS, - NG0636 gcr, - NG0627 gyrA, - NG0629 NG0631 NG0634 tpn, - NG0628 mltB, - NG0626
* Calculated from Protein Sequence

Gene ID: NG0629

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gyrA  

Definition:
DNA gyrase subunit A

Gene Start:
621186

Gene Stop:
618439

Gene Length:
2748

Molecular Weight*:
101382

pI*:
5.30

Net Charge*:
-21.14

EC:
5.99.1.3  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Primary Evidence:
Belland,R.J., Morrison,S.G., Ison,C. and Huang,W.M. Neisseria gonorrhoeae acquires mutations in analogous regions of gyrA and parC in fluoroquinolone-resistant isolates. Mol. Microbiol. 14 (2), 371-380 (1994) Medline: 95131758.

Secondary Evidence:
Kureishi,A., Diver,J.M., Beckthold,B., Schollaardt,T. andBryan,L.E. Cloning and nucleotide sequence of Pseudomonas aeruginosa DNA gyrase gyrA gene from strain PAO1 and
quinolone-resistant clinicalisolates. Antimicrob. Agents Chemother. 38 (9): 1944-1952 (1994) [Medline: 95110050].

Rosanas,A., Barbe,J. and Gibert,I. Cloning and sequencing of the gyrA gene from the plant pathogen Erwinia carotovora. Gene 161 (1): 11-14 (1995) [Medline: 95369719].

Oram,M. and Fisher,L.M. 4-Quinolone resistance mutations in the DNA gyrase of Escherichia coli clinical isolates identified by using the polymerase chain reaction. Antimicrob. Agents Chemother. 35 (2): 387-389 (1991) [Medline: 91221620].

Hallett,P. and Maxwell,A. Novel quinolone resistance mutations of the Escherichia coli DNA gyrase A protein: enzymatic analysis of the mutant proteins. Antimicrob. Agents Chemother. 35 (2): 335-340 (1991) [Medline: 91221607].

Morais Cabral,J.H., Jackson,A.P., Smith,C.V., Shikotra,N., Maxwell,A. and Liddington,R.C. Crystal structure of the breakage-reunion domain of DNA gyrase . Nature 388 (6645): 903-906 (1997) [Medline: 97422287].

Comment:
From GenBANK (gi:1346236): DNA gyrase negatively supercoils closed circular double-stranded DNA in an ATP-dependent manner and also catalyzes the interconversion of other topological isomers of
double-stranded DNA rings, including catenanes and knotted rings. Catalytic activity: ATP-dependent breakage, passage and rejoining of double-stranded DNA. This is made up of two chains; the A chain is responsible for dna breakage and rejoining; the B chain catalyzes ATP hydrolysis. The enzyme forms an A2B2 tetramer.

See also NG1772, DNA gyrase chain B.

Oklahoma ID: NGO.629c

Blast Summary:  PSI-Blast Search
NG0629 is 99% identical to a previously sequenced Neisseria gonorrhoeae DNA gyrase subunit A protein in GenBank, 529408.

Numerous significant hits in gapped BLAST to DNA gyrase subunit A; e.g. residues 13-893 are 54% similar to AE004062 DNA gyrase subunit A of Xylella fastidiosa.

Residues 1-916 are 97% similar to NMB1384 and NMA1599, both DNA gyrase subunit A of N.meningitidis (11271030, 11271028).


COGS Summary:  COGS Search
BeTs to 14 clades of COG0188
COG name: DNA gyrase (topoisomerase II) A subunit
Functional Class:  L
The phylogenetic pattern of COG0188 is a---yqvCEBrHujGPOlINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002205 (DNA gyrase/topoisomerase IV, subunit A) with a combined E-value of 2e-85.
    IPB002205A    40-58
    IPB002205B    73-108
    IPB002205C    121-135
    IPB002205D    177-198
    IPB002205E    220-229
    IPB002205F    239-248


ProDom Summary:  Protein Domain Search
Residues 833-895 are 49% similar to a (DNA GYRASE SUBUNIT A) protein domain (PD000870) which is seen in GYRA_PSEAE.

Residues 423-458 are 94% similar to a (DNA GYRASE SUBUNIT A) protein domain (PD132381) which is seen in GYRA_NEIGO.

Residues 1-27 are identical to a (DNA GYRASE SUBUNIT A) protein domain (PD160137) which is seen in GYRA_NEIGO.

Residues 879-916 are identical to a (DNA GYRASE SUBUNIT A) protein domain (PD102312) which is seen in GYRA_NEIGO.



Paralogs:  Local Blast Search


NG0629 is paralogously related to NG1259 (DNA topoisomerase IV subunit A) (1e-94).


Pfam Summary:  Pfam Search
Residues 548 to 597 (E-value = 7e-12) place NG0629 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 598 to 650 (E-value = 4.1e-14) place NG0629 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 654 to 701 (E-value = 3.2e-12) place NG0629 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 702 to 789 (E-value = 1.9e-10) place NG0629 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 795 to 845 (E-value = 2.7e-12) place NG0629 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 846 to 895 (E-value = 6.7e-18) place NG0629 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
203  
458
non-globular  
824  
916

PDB Hit:
pdb|1AB4|1AB4 59KDA FRAGMENT OF GYRASE A FROM E. COLI 590.0 0e+00
pdb|1BGW|1BGW TOPOISOMERASE RESIDUES 410 - 1202, 79.2 3e-15
pdb|1AB4|1AB4 59KDA FRAGMENT OF GYRASE A FROM E. COLI 756.0 0.000000
pdb|1BGW|1BGW TOP

Gene Protein Sequence:
MTDATIRHDHKFALETLPVSLEDEMRKSYLDYAMSVIVGRALPDVRDGLK
PVHRRVLYAMHELKNNWNAAYKKSARIVGDVIGKYHPHGDSAVYDTIVRM
AQNFAMRYVLIDGQGNFGSVDGLAAAAMRYTEIRMAKISHEMLADIEEET
VNFGPNYDGSEHEPLVLPTRFPTLLVNGSSGIAVGMATNIPPHNLTDTIN
ACLRLLDEPKTEIDELIDIIQAPDFPTGATIYGLGGVREGYKTGRGRVVI
RGKTHIEPIGKNGEREAIVIDEIPYQVNKAKLVEKIGDLVREKTLEGISE
LRDESDKSGMRVVIELKRNENAEVVLNQLYKLTPLQDSFGINMVVLVDGQ
PRLLNLKQILSEFLRHRREVVTRRTLFRLKKARHEGHIAEGKAVALSNID
EIIKLIKESPNAAEAKEKLLARPWRSSLVEEMLTRSGLDLEMMRPEGLAA
NIGLKKQGYYLSEIQADAILRMSLRNLTGLDQKEIIESYKNLMGKIIDFV
DILSKPERITQIIRDELEEIKTNYGDERRSEINPFGGDIADEDLIPQREM
VVTLTHGGYIKTQPTTDYQAQRRGGRGKQAAATKDEDFIETLFVANTHDY
LMCFTNLGKCHWIKVYKLPEGGRNSRGRPINNVIQLEEGEKVSAILAVRE
FPEDQYVFFATAQGMVKKVQLSAFKNVRAQGIKAIALKEGDYLVGAAQTG
GADDIMLFSNLGKAIRFNEYWEKSGNDEAEDADIETEISDDLEDETADNE
NTLPSGKNGVRPSGRGSGGLRGMRLPADGKIVSLITFAPETEESGLQVLT
ATANGYGKRTPIADYSRKNKGGQGSIAINTGERNGDLVAATLVGETDDLM
LITSGGVLIRTKVEQIRETGRAAAGVKLINLDEGETLVSLERVAEDESEL
SGASVISNVTEPEAEN

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGACGCAACCATCCGCCACGACCACAAATTCGCCCTCGAAACCCT
GCCCGTCAGCCTTGAAGACGAAATGCGCAAAAGCTATCTCGACTACGCCA
TGAGCGTCATTGTCGGGCGCGCGCTGCCGGACGTTCGCGACGGCCTAAAG
CCGGTGCACCGGCGCGTACTGTACGCGATGCACGAGCTGAAAAATAACTG
GAATGCCGCCTACAAAAAATCGGCGCGCATCGTCGGCGACGTCATCGGTA
AATACCACCCCCACGGCGATTCCGCAGTTTACGACACCATCGTCCGTATG
GCGCAAAATTTCGCTATGCGTTATGTGCTGATAGACGGACAGGGCAACTT
CGGATCGGTGGACGGGCTTGCCGCCGCAGCCATGCGCTATACCGAAATCC
GCATGGCGAAAATCTCACATGAAATGCTGGCAGACATTGAGGAAGAAACC
GTTAATTTCGGCCCGAACTACGACGGTAGCGAACACGAGCCGCTTGTACT
GCCGACCCGTTTCCCCACACTGCTCGTCAACGGCTCGTCCGGTATCGCCG
TCGGTATGGCGACCAACATCCCGCCGCACAACCTCACCGACACCATCAAC
GCCTGTCTGCGTCTTTTGGACGAACCCAAAACCGAAATCGACGAACTGAT
CGACATTATCCAAGCCCCCGACTTCCCGACCGGGGCAACCATCTACGGCT
TGGGCGGCGTGCGCGAAGGCTATAAAACAGGCCGCGGCCGCGTCGTTATA
CGCGGTAAGACCCATATCGAACCCATAGGCAAAAACGGCGAACGCGAAGC
CATCGTTATCGACGAAATCCCCTATCAGGTCAACAAAGCCAAGTTGGTCG
AGAAAATCGGCGATTTGGTTCGGGAAAAAACGCTGGAAGGCATTTCCGAG
CTCCGCGACGAATCCGACAAATCCGGGATGCGCGTCGTTATCGAGCTGAA
ACGCAACGAAAATGCCGAAGTCGTCTTAAACCAACTCTACAAACTGACTC
CGCTGCAAGACAGTTTCGGCATCAATATGGTTGTTTTGGTCGACGGACAA
CCGCGCCTGTTAAACCTGAAACAGATTCTCTCCGAATTCCTGCGCCACCG
CCGCGAAGTCGTTACCCGACGTACGCTTTTCCGGCTGAAGAAGGCACGCC
ATGAAGGGCATATCGCCGAAGGCAAAGCCGTCGCACTGTCCAATATCGAT
GAAATCATCAAGCTCATCAAAGAATCGCCCAACGCGGCCGAGGCCAAAGA
AAAACTGCTTGCGCGCCCTTGGCGCAGCAGCCTCGTTGAAGAAATGCTGA
CGCGTTCCGGTCTGGATTTGGAAATGATGCGTCCGGAAGGATTGGCTGCA
AACATTGGTCTGAAAAAACAAGGTTATTACCTGAGCGAGATTCAGGCAGA
TGCTATTTTACGCATGAGCCTGCGAAACCTGACCGGCCTCGATCAGAAAG
AAATTATCGAAAGCTACAAAAACCTGATGGGTAAAATCATCGACTTTGTG
GATATCCTCTCCAAACCCGAACGCATTACCCAAATCATCCGTGACGAACT
GGAAGAAATCAAAACCAACTATGGCGACGAACGCCGCAGCGAAATCAACC
CGTTCGGCGGCGACATTGCCGATGAAGACCTGATTCCGCAACGCGAAATG
GTCGTGACCCTGACCCACGGCGGCTATATAAAAACCCAGCCGACCACCGA
CTATCAGGCTCAGCGTCGCGGCGGGCGCGGCAAACAGGCGGCTGCCACCA
AAGACGAAGACTTTATCGAAACCCTGTTTGTTGCCAACACGCATGACTAT
TTGATGTGTTTTACCAACCTCGGCAAGTGCCACTGGATTAAGGTTTACAA
ACTGCCCGAAGGCGGACGCAACAGCCGCGGCCGTCCGATTAACAACGTCA
TCCAGCTGGAAGAAGGCGAAAAAGTCAGCGCGATTCTGGCAGTACGCGAG
TTTCCCGAAGACCAATACGTCTTCTTCGCCACCGCGCAGGGAATGGTGAA
AAAAGTCCAACTTTCCGCCTTTAAAAACGTCCGCGCCCAAGGCATTAAAG
CCATCGCACTCAAAGAAGGCGACTACCTCGTCGGCGCTGCGCAAACAGGC
GGTGCGGACGACATTATGTTGTTCTCCAACTTGGGCAAAGCCATCCGCTT
CAACGAATACTGGGAAAAATCCGGCAACGACGAAGCGGAAGATGCCGACA
TCGAAACCGAGATTTCAGACGACCTCGAAGACGAAACCGCCGACAACGAA
AACACCCTGCCAAGCGGCAAAAACGGCGTGCGTCCGTCCGGTCGCGGCAG
CGGCGGTTTGCGCGGTATGCGCCTGCCTGCCGACGGCAAAATCGTCAGCC
TGATTACCTTCGCCCCTGAAACCGAAGAAAGCGGTTTGCAAGTTTTAACC
GCCACCGCCAACGGATACGGAAAACGCACCCCGATTGCCGATTACAGCCG
CAAAAACAAAGGCGGGCAAGGCAGTATTGCCATTAACACCGGCGAGCGCA
ACGGCGATTTGGTCGCCGCAACCTTGGTCGGCGAAACCGACGATTTGATG
CTGATTACCAGCGGCGGCGTGCTTATCCGTACCAAAGTCGAACAAATCCG
CGAAACCGGCCGCGCCGCAGCAGGCGTGAAACTGATTAACTTGGACGAAG
GCGAAACCTTGGTATCGCTGGAACGTGTTGCCGAAGACGAATCCGAACTC
TCCGGCGCTTCTGTAATTTCCAATGTAACCGAACCGGAAGCCGAGAAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy