Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0515.1 IGR0510 IGR0508 IGR0511 IGR0515 IGR0509 IGR0512 IGR0514 IGR0513 NG0616 NG0613 mltD, - NG0608 NG0615.1 NG0609 plsC, - NG0611 fpg, - NG0610 rir2,nrdB, - NG0615 rir1,nrdA, - NG0614 NG0616 NG0613 mltD, - NG0608 NG0615.1 NG0609 plsC, - NG0611 fpg, - NG0610 rir2,nrdB, - NG0615 rir1,nrdA, - NG0614 NG0616 NG0613 mltD, - NG0608 NG0615.1 NG0609 plsC, - NG0611 fpg, - NG0610 rir2,nrdB, - NG0615 rir1,nrdA, - NG0614
* Calculated from Protein Sequence

Gene ID: NG0613

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Neisseria-specific protein, uncharacterized

Gene Start:
599778

Gene Stop:
599470

Gene Length:
309

Molecular Weight*:
11831

pI*:
10.90

Net Charge*:
10.85

EC:
 

Functional Class:
Neisseria-specific protein  
Unknown  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.613c

Blast Summary:  PSI-Blast Search
Residues 1-103 are 96% similar to NMB1293, and are 94% similar to NMA1503, both hypothetical proteins of N.meningitidis (11282729, 11282728). No hits to any other organism.


COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG0613 is paralogously related to NG1083 (hypothetical protein) (7e-04).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
19
cleavable N-terminal sequence  
1  
19

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MLAILLSAILGLVSTTAAAGTSEPAHRHTKHISKANKQMLHPECRKYLER
RAAWYRSQGNVQELRENKKARKAFRTLPYAEQKIQCRAAYEAFDDFDGGR
FRR

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTGCCATACTGTTGTCTGCAATACTGGGACTGGTATCAACAACTGC
CGCTGCCGGTACGTCAGAACCCGCCCACCGACATACCAAACATATCAGCA
AGGCAAACAAGCAGATGCTGCACCCCGAATGCAGGAAATATTTGGAACGC
CGTGCCGCGTGGTACCGATCGCAAGGCAACGTGCAGGAATTGCGCGAAAA
CAAAAAGGCGCGCAAAGCATTCCGCACCCTGCCTTATGCGGAACAGAAAA
TCCAATGCCGGGCGGCTTATGAGGCTTTCGATGATTTCGACGGCGGCAGG
TTCCGCCGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy