Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0504 IGR0502.2 IGR0502 IGR0502.1 IGR0505 IGR0499 IGR0500 IGR0503 IGR0506 IGR0501 hip,ihfB, - NG0603 NG0601 ndk, - NG0597 kcy,mssA,cmk, - NG0605 estD, - NG0600 NG0601.1 NG0596 NG0598 NG0606 rpS1, - NG0604 merR, - NG0602 hip,ihfB, - NG0603 NG0601 ndk, - NG0597 kcy,mssA,cmk, - NG0605 estD, - NG0600 NG0601.1 NG0596 NG0598 NG0606 rpS1, - NG0604 merR, - NG0602 hip,ihfB, - NG0603 ndk, - NG0597 kcy,mssA,cmk, - NG0605 estD, - NG0600 NG0601.1 NG0596 NG0598 NG0606 rpS1, - NG0604 NG0601 merR, - NG0602
* Calculated from Protein Sequence

Gene ID: NG0601.1

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
formaldehyde dehydrogenase

Gene Start:
588315

Gene Stop:
587542

Gene Length:
774

Molecular Weight*:
27448

pI*:
6.60

Net Charge*:
-1.79

EC:
1.2.1.1  

Functional Class:
Unassigned  

Pathway: pathway table
Methane metabolism
Pyruvate metabolism

Comment:


Blast Summary:  PSI-Blast Search
Residues 17-254 are 96% similar to U32703, an alcohol dehydrogenase, class III (adhC) from Haemophilus influenzae Rd.

Residues 26-254 are 88% similar to D38504, a formaldehyde dehydrogenase from Escherichia coli.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1062
COG name: Alcohol dehydrogenase class III and related dehydrogenases
Functional Class:  C,R
The phylogenetic pattern of COG1062 is ----y-vcE-Rh---------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002328 (Zinc-containing alcohol dehydrogenase) with a combined E-value of 1.4e-60.
    IPB002328A    39-70
    IPB002328B    82-107
    IPB002328C    117-131
    IPB002328D    177-224
***** IPB002364 (Quinone oxidoreductase/zeta-crystallin) with a combined E-value of 1.7e-12.
    IPB002364    82-109


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


NG0601.1 is paralogously related to NG1442 (alcohol dehydrogenase) (3e-19), NG0711 (putative zinc-containing dehydrogenase) (1e-13) and NG0186 (zinc-binding alcohol dehydrogenase) (1e-05).


Pfam Summary:  Pfam Search
Residues 35 to 258 (E-value = 2.8e-31) place NG0601.1 in the ADH_zinc_N family which is described as Zinc-binding dehydrogenase (PF00107)

PDB Hit:
pdb|1M6H|1M6H-A HUMAN GLUTATHIONE-DEPENDENT FORMALDEHYDE 254.0 2e-68
pdb|1CDO|1CDO-A ALCOHOL DEHYDROGENASE (E.C.1.1.1.1) (EE ISOZYME)208.0 1e-54
pdb|1AGN|1AGN-A X-RAY STRUCTURE OF HUMAN SIGMA ALCOHOL 190.0 2e-49
pdb|1D1T|1D1T-A MUTA

Gene Protein Sequence:
MLLRQGYFVNELRGKTMEMKQTDSTIKSRAAVAFAPNQPLQIVEIDVEMP
RKDEVLIRNTHTGVCHTDAFTLSGSDPEGVFPVVLGHEGAGVVVAVGEGV
SSVKPGNHVIPLYTAECGECEFCLSGKTNLCVSVRDTQGKGLMPDGTTRF
SYQGQPIYHYMGCSTFSEYSVVAEVSLAKINPKANHEQVCLLGCGVTTGI
GAVHNTAKVQEGDSVAVFGLGAIGLAVVQGARQAKAGRIIAIDTNPAKFE
LAKQCWCN

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGCTCAGGCAAGGCTATTTTGTTAATGAATTAAGAGGAAAGACAAT
GGAAATGAAACAAACCGATTCAACCATCAAATCTCGTGCGGCGGTGGCAT
TCGCCCCTAACCAACCCTTACAAATTGTGGAAATCGACGTGGAAATGCCG
CGTAAAGACGAGGTGTTAATTCGTAACACCCACACTGGCGTGTGCCATAC
TGATGCATTTACCTTATCAGGAAGCGATCCTGAAGGCGTATTCCCTGTGG
TGCTTGGACACGAAGGTGCGGGTGTGGTCGTTGCTGTGGGCGAGGGTGTG
TCAAGCGTAAAACCGGGTAATCACGTCATTCCGCTTTACACCGCAGAATG
TGGCGAATGTGAGTTTTGCCTCTCGGGTAAAACCAATTTATGCGTCTCAG
TGCGTGATACACAAGGTAAAGGCTTAATGCCAGACGGCACGACGCGTTTT
TCTTATCAAGGTCAGCCGATTTATCACTATATGGGCTGTTCGACTTTCAG
TGAATATTCTGTTGTTGCCGAAGTTTCACTGGCGAAAATCAACCCGAAAG
CCAACCACGAACAAGTATGTTTGCTCGGCTGCGGCGTTACCACTGGTATT
GGTGCGGTACATAACACGGCAAAAGTACAAGAAGGCGATTCTGTTGCCGT
GTTTGGCTTGGGAGCGATTGGTTTGGCTGTGGTGCAAGGTGCGCGTCAAG
CCAAAGCCGGTCGCATTATCGCCATTGATACCAATCCTGCAAAATTCGAG
TTGGCAAAACAGTGTTGGTGCAAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy