Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0498 IGR0504 IGR0502.2 IGR0502 IGR0502.1 IGR0505 IGR0499 IGR0500 IGR0503 IGR0506 IGR0501 hip,ihfB, - NG0603 NG0601 ndk, - NG0597 kcy,mssA,cmk, - NG0605 estD, - NG0600 pilF, - NG0595 NG0601.1 NG0596 NG0598 NG0606 rpS1, - NG0604 merR, - NG0602 hip,ihfB, - NG0603 NG0601 ndk, - NG0597 kcy,mssA,cmk, - NG0605 estD, - NG0600 pilF, - NG0595 NG0601.1 NG0596 NG0598 NG0606 rpS1, - NG0604 merR, - NG0602 hip,ihfB, - NG0603 ndk, - NG0597 kcy,mssA,cmk, - NG0605 estD, - NG0600 pilF, - NG0595 NG0601.1 NG0596 NG0598 NG0606 rpS1, - NG0604 NG0601 merR, - NG0602
* Calculated from Protein Sequence

Gene ID: NG0601

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
formaldehyde dehydrogenase

Gene Start:
587432

Gene Stop:
587133

Gene Length:
300

Molecular Weight*:
11038

pI*:
7.00

Net Charge*:
0.00

EC:
1.2.1.1  

Functional Class:
Unassigned  

Pathway: pathway table
Methane metabolism
Pyruvate metabolism

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-100 are 93% similar to residues 279-378 in U32703, an alcohol dehydrogenase, class III (adhC) from Haemophilus influenzae Rd.

Residues 1-100 are 85% similar to residues 279-387 in D38504, a formaldehyde dehydrogenase from Escherichia coli.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1062
COG name: Alcohol dehydrogenase class III and related dehydrogenases
Functional Class:  C,R
The phylogenetic pattern of COG1062 is ----y-vcE-Rh---------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


NG0601 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|1M6H|1M6H-A HUMAN GLUTATHIONE-DEPENDENT FORMALDEHYDE 129.0 1e-31
pdb|1CDO|1CDO-A ALCOHOL DEHYDROGENASE (E.C.1.1.1.1) (EE ISOZYME)103.0 8e-24
pdb|1HDZ|1HDZ-A ALCOHOL DEHYDROGENASE (E.C.1.1.1.1) (BETA-1 94.0 7e-21
pdb|1DEH|1DEH-A CRYS

Gene Protein Sequence:
MRQALESAHRGWGQSIIIGVADAGQEISTRPFQSVTGRVWKGSAFGGVKG
RSELPKMVEDSMKGDIQLEPFVTHAMTLDQINEAFELMHEGKSIRAVIHY


Gene Nucleotide Sequence:  Sequence Viewer
ATGCGTCAGGCATTAGAAAGTGCACACCGAGGTTGGGGACAATCCATCAT
CATCGGCGTAGCGGATGCAGGACAAGAAATTTCAACGCGTCCGTTCCAAT
CGGTAACAGGCCGTGTTTGGAAAGGCTCGGCATTTGGTGGTGTTAAAGGC
CGCTCCGAGCTTCCGAAAATGGTGGAGGATTCAATGAAAGGCGATATCCA
ATTAGAACCATTTGTGACCCATGCAATGACCCTTGATCAAATCAATGAAG
CCTTTGAGTTAATGCACGAAGGTAAATCGATCCGCGCTGTTATTCATTAC



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy