Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0498 IGR0497 IGR0504 IGR0502.2 IGR0502 IGR0502.1 IGR0505 IGR0499 IGR0500 IGR0503 IGR0501 hip,ihfB, - NG0603 NG0601 ndk, - NG0597 kcy,mssA,cmk, - NG0605 estD, - NG0600 pilF, - NG0595 NG0601.1 NG0596 NG0598 gcpE,ispG, - NG0594 rpS1, - NG0604 merR, - NG0602 hip,ihfB, - NG0603 NG0601 ndk, - NG0597 kcy,mssA,cmk, - NG0605 estD, - NG0600 pilF, - NG0595 NG0601.1 NG0596 NG0598 gcpE,ispG, - NG0594 rpS1, - NG0604 merR, - NG0602 hip,ihfB, - NG0603 ndk, - NG0597 kcy,mssA,cmk, - NG0605 estD, - NG0600 pilF, - NG0595 NG0601.1 NG0596 NG0598 gcpE,ispG, - NG0594 rpS1, - NG0604 NG0601 merR, - NG0602
* Calculated from Protein Sequence

Gene ID: NG0600

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
estD  

Definition:
esterase D

Gene Start:
587040

Gene Stop:
586297

Gene Length:
744

Molecular Weight*:
28222

pI*:
6.40

Net Charge*:
-2.93

EC:
3.1.1.1  

Functional Class:
Unassigned  

Pathway: pathway table

Comment:
From GenBANK (gi:544254): In humans, esterase D catalyzes the reaction: carboxylic ester + H2O = an alcohol + a carboxylic anion.

From Medline (86313576): The esterase D gene is a genetic marker for retinoblastoma, an inherited condition characterized by intraocular tumors in humans.

Oklahoma ID: NGO.600c

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to hypothetical proteins and esterases; e.g. residues 1-247 are 57% similar to D90904, esterase, of Synechocystis sp.

Residues 1-248 are 93% similar to NMB1305 and NMA1519, both esterases, of N.meningitidis (11279783, 11279782).

COGS Summary:  COGS Search
BeTs to 3 clades of COG0627
COG name: Predicted esterase
Functional Class:  R
The phylogenetic pattern of COG0627 is ----y--cE--h---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000801 (Putative esterase) with a combined E-value of 9.3e-43.
    IPB000801A    50-61
    IPB000801B    73-99
    IPB000801C    116-125
    IPB000801D    144-173


ProDom Summary:  Protein Domain Search
Residues 52-164 are 91% similar to a (PROTEIN PRECURSOR SIGNAL ANTIGEN) protein domain (PD002291) which is seen in YAIM_HAEIN.

Residues 1-36 are 94% similar to a (HYDROLASE ESTERASE PROTEIN INTERGENIC) protein domain (PD007616) which is seen in YAIM_HAEIN.

Residues 178-247 are 94% similar to a (HYDROLASE ESTERASE PROTEIN INTERGENIC) protein domain (PD007617) which is seen in YAIM_HAEIN.



Paralogs:  Local Blast Search


NG0600 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 242 (E-value = 2.2e-96) place NG0600 in the Esterase family which is described as Putative esterase (PF00756)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MKFAVYLPDNPENQPLGVIYWLSGLTCTEQNFITKSSFRRYAAEHQVVVV
APDTGPRGEQVPNGAAYDLGQGAGFYLNATEQPWAANYQMYDYILNELPR
LIEEHFPTNGKRSIMGHSMDGHGALVLALRNREHYQSVSAFSPILSPSLV
PWGEKAFTAYLGKDREKWQQYDANSLIQQGYKVQGMRIDQGLEDEFLPTQ
LRTKDFIETCRAANQPIDVRFHKGYDHSYYFIASFIGEHIAYHAAFLK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTTGCCGTCTATTTGCCGGATAATCCGGAAAATCAACCGCTTGG
TGTGATTTATTGGCTTTCCGGCTTGACGTGTACGGAACAAAATTTCATTA
CCAAATCGAGCTTCCGGCGTTATGCGGCAGAACATCAAGTGGTTGTGGTC
GCCCCCGATACCGGCCCTCGCGGAGAGCAAGTGCCGAACGGTGCCGCTTA
TGATTTAGGACAGGGGGCAGGCTTTTATTTGAATGCGACCGAACAGCCTT
GGGCGGCGAATTATCAAATGTATGATTACATTTTGAACGAGTTGCCCCGT
CTGATTGAGGAGCATTTTCCTACCAACGGCAAACGTTCCATTATGGGGCA
TTCGATGGACGGACACGGCGCATTGGTATTGGCACTACGGAATCGGGAAC
ATTATCAAAGTGTTTCTGCCTTTTCGCCTATTTTATCGCCAAGCCTCGTA
CCGTGGGGAGAAAAAGCCTTTACTGCTTATTTAGGGAAAGACCGTGAAAA
ATGGCAGCAATATGATGCTAACTCACTCATTCAACAAGGCTATAAAGTGC
AAGGTATGCGTATCGATCAGGGCTTGGAAGATGAGTTTTTGCCGACACAA
TTGCGTACCAAAGATTTTATCGAAACCTGTCGTGCGGCAAATCAGCCAAT
CGATGTGCGTTTCCATAAAGGATACGATCACAGCTATTACTTCATCGCCA
GTTTTATTGGTGAGCATATCGCTTATCACGCCGCATTTTTGAAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy